enetoglyc

 

Wiki

The master copies of EMBOSS documentation are available at http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

Please help by correcting and extending the Wiki pages.

Function

Reports mucin type GalNAc O-glycosylation sites in mammalian proteins

Description

The NetOglyc server produces neural network predictions of mucin type GalNAc O-glycosylation sites in mammalian proteins.

Usage

Here is a sample session with enetoglyc


% enetoglyc 
Reports mucin type GalNAc O-glycosylation sites in mammalian proteins
Input (aligned) sequence set: LEUK_RAT.fsa
Output file [leuk_rat.enetoglyc]: 

Go to the input files for this example
Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          seqset     (Aligned) sequence set filename and optional
                                  format, or reference (input USA)
  [-outfile]           outfile    [*.enetoglyc] Output file name

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers:
   -plot               boolean    [N] Produce graphics
   -signalp            boolean    [N] Run signalp on the sequences

   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-outfile" associated qualifiers
   -odirectory2        string     Output directory

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages

Qualifier Type Description Allowed values Default
Standard (Mandatory) qualifiers
[-sequence]
(Parameter 1)
seqset (Aligned) sequence set filename and optional format, or reference (input USA) Readable set of sequences Required
[-outfile]
(Parameter 2)
outfile Output file name Output file <*>.enetoglyc
Additional (Optional) qualifiers
(none)
Advanced (Unprompted) qualifiers
-plot boolean Produce graphics Boolean value Yes/No No
-signalp boolean Run signalp on the sequences Boolean value Yes/No No

Input file format

enetoglyc reads any normal sequence USAs.

Input files for usage example

File: LEUK_RAT.fsa

>LEUK_RAT P13838 LEUKOSIALIN PRECURSOR (LEUCOCYTE SIALOGLYCOPROTEIN) (SIALOPHORIN) (CD43) (W3/13 ANTIGEN) (FRAGMENT). - RATTUS NORVEGICUS (RAT).
WAQVVSQENLPNTMTMLPFTPNSESPSTSEALSTYSSIATVPVTEDPKESISPWGQTTAP
ASSIPLGTPELSSFFFTSAGASGNTPVPELTTSQEVSTEASLVLFPKSSGVASDPPVTIT
NPATSSAVASTSLETFKGTSAPPVTVTSSTMTSGPFVATTVSSETSGPPVTMATGSLGPS
KETHGLSATIATSSGESSSVAGGTPVFSTKISTTSTPNPITTVPPRPGSSGMLLVSMLIA
LTVVLVLVALLLLWRQRQKRRTGALTLSRGGKRNGTVDAWAGPARVPDEEATTASGSGGN
KSSGAPETDGSGQRPTLTTFFSRRKSRQGSVALEELKPGTGPNLKGEEEPLVGSEDEAVE
TPTSDGPQAKDGAAPQSL

Output file format

Output files for usage example

File: leuk_rat.enetoglyc

Name:  LEUK_RAT		Length:  378
WAQVVSQENLPNTMTMLPFTPNSESPSTSEALSTYSSIATVPVTEDPKESISPWGQTTAPASSIPLGTPELSSFFFTSAG
ASGNTPVPELTTSQEVSTEASLVLFPKSSGVASDPPVTITNPATSSAVASTSLETFKGTSAPPVTVTSSTMTSGPFVATT
VSSETSGPPVTMATGSLGPSKETHGLSATIATSSGESSSVAGGTPVFSTKISTTSTPNPITTVPPRPGSSGMLLVSMLIA
LTVVLVLVALLLLWRQRQKRRTGALTLSRGGKRNGTVDAWAGPARVPDEEATTASGSGGNKSSGAPETDGSGQRPTLTTF
FSRRKSRQGSVALEELKPGTGPNLKGEEEPLVGSEDEAVETPTSDGPQAKDGAAPQSL
..............T....T....S.STS...ST.SS..T...T.....S.S....TT.........T....S...T...
....T.....TT.....T..............S....T.T...TSS...STS..T...TS....T.TSST.TS.....TT
.SS.TS....T..T.S...S..T.....T..TSS...SS....T...ST..STTST....TT..................
...................................................TT.S.S....SS....T.......T....
........................................T.T.............S.

Name                         S/T   Pos  G-score I-score Y/N  Comment
----------------------------------------------------------------------------
LEUK_RAT                      S      6   0.379   0.054   .   -
LEUK_RAT                      T     13   0.498   0.039   .   -
LEUK_RAT                      T     15   0.535   0.095   T   -
LEUK_RAT                      T     20   0.567   0.070   T   -
LEUK_RAT                      S     23   0.469   0.059   .   -
LEUK_RAT                      S     25   0.502   0.029   S   -
LEUK_RAT                      S     27   0.526   0.190   S   -
LEUK_RAT                      T     28   0.659   0.100   T   -
LEUK_RAT                      S     29   0.552   0.153   S   -
LEUK_RAT                      S     33   0.567   0.035   S   -
LEUK_RAT                      T     34   0.650   0.097   T   -
LEUK_RAT                      S     36   0.557   0.047   S   -
LEUK_RAT                      S     37   0.550   0.046   S   -
LEUK_RAT                      T     40   0.653   0.087   T   -
LEUK_RAT                      T     44   0.609   0.408   T   -
LEUK_RAT                      S     50   0.565   0.065   S   -
LEUK_RAT                      S     52   0.554   0.053   S   -
LEUK_RAT                      T     57   0.669   0.045   T   -
LEUK_RAT                      T     58   0.661   0.050   T   -
LEUK_RAT                      S     62   0.477   0.084   .   -
LEUK_RAT                      S     63   0.457   0.277   .   -
LEUK_RAT                      T     68   0.576   0.081   T   -
LEUK_RAT                      S     72   0.497   0.040   .   -
LEUK_RAT                      S     73   0.503   0.034   S   -
LEUK_RAT                      T     77   0.592   0.054   T   -
LEUK_RAT                      S     78   0.466   0.050   .   -
LEUK_RAT                      S     82   0.459   0.163   .   -
LEUK_RAT                      T     85   0.562   0.110   T   -
LEUK_RAT                      T     91   0.592   0.072   T   -
LEUK_RAT                      T     92   0.577   0.152   T   -
LEUK_RAT                      S     93   0.451   0.065   .   -
LEUK_RAT                      S     97   0.454   0.048   .   -
LEUK_RAT                      T     98   0.570   0.190   T   -
LEUK_RAT                      S    101   0.498   0.029   .   -
LEUK_RAT                      S    108   0.461   0.048   .   -
LEUK_RAT                      S    109   0.465   0.043   .   -


  [Part of this file has been deleted for brevity]

LEUK_RAT                      S    180   0.516   0.121   S   -
LEUK_RAT                      T    183   0.633   0.077   T   -
LEUK_RAT                      S    187   0.492   0.039   .   -
LEUK_RAT                      T    189   0.608   0.202   T   -
LEUK_RAT                      T    192   0.597   0.255   T   -
LEUK_RAT                      S    193   0.520   0.033   S   -
LEUK_RAT                      S    194   0.526   0.033   S   -
LEUK_RAT                      S    197   0.478   0.037   .   -
LEUK_RAT                      S    198   0.501   0.031   S   -
LEUK_RAT                      S    199   0.503   0.104   S   -
LEUK_RAT                      T    204   0.696   0.099   T   -
LEUK_RAT                      S    208   0.600   0.078   S   -
LEUK_RAT                      T    209   0.700   0.298   T   -
LEUK_RAT                      S    212   0.615   0.041   S   -
LEUK_RAT                      T    213   0.707   0.070   T   -
LEUK_RAT                      T    214   0.712   0.644   T   -
LEUK_RAT                      S    215   0.613   0.046   S   -
LEUK_RAT                      T    216   0.711   0.609   T   -
LEUK_RAT                      T    221   0.670   0.193   T   -
LEUK_RAT                      T    222   0.650   0.465   T   -
LEUK_RAT                      S    229   0.428   0.064   .   -
LEUK_RAT                      S    230   0.379   0.056   .   -
LEUK_RAT                      S    236   0.215   0.053   .   -
LEUK_RAT                      T    242   0.113   0.093   .   -
LEUK_RAT                      T    262   0.193   0.055   .   -
LEUK_RAT                      T    266   0.228   0.060   .   -
LEUK_RAT                      S    268   0.201   0.073   .   -
LEUK_RAT                      T    276   0.402   0.045   .   -
LEUK_RAT                      T    292   0.603   0.232   T   -
LEUK_RAT                      T    293   0.616   0.413   T   -
LEUK_RAT                      S    295   0.507   0.098   S   -
LEUK_RAT                      S    297   0.533   0.047   S   -
LEUK_RAT                      S    302   0.520   0.038   S   -
LEUK_RAT                      S    303   0.503   0.038   S   -
LEUK_RAT                      T    308   0.577   0.208   T   -
LEUK_RAT                      S    311   0.385   0.072   .   -
LEUK_RAT                      T    316   0.506   0.221   T   -
LEUK_RAT                      T    318   0.496   0.070   .   -
LEUK_RAT                      T    319   0.469   0.045   .   -
LEUK_RAT                      S    322   0.254   0.055   .   -
LEUK_RAT                      S    326   0.292   0.024   .   -
LEUK_RAT                      S    330   0.288   0.047   .   -
LEUK_RAT                      T    340   0.422   0.058   .   -
LEUK_RAT                      S    354   0.463   0.034   .   -
LEUK_RAT                      T    361   0.594   0.214   T   -
LEUK_RAT                      T    363   0.598   0.403   T   -
LEUK_RAT                      S    364   0.492   0.463   .   -
LEUK_RAT                      S    377   0.579   0.021   S   -
----------------------------------------------------------------------------


Data files

None.

Notes

None.

References

None.

Warnings

None.

Diagnostic Error Messages

None.

Exit status

It always exits with status 0.

Known bugs

None.

See also

Program name Description
antigenic Finds antigenic sites in proteins
digest Reports on protein proteolytic enzyme or reagent cleavage sites
echlorop Reports presence of chloroplast transit peptides
eiprscan Motif detection
elipop Prediction of lipoproteins
emast Motif detection
ememe Multiple EM for Motif Elicitation
ememetext Multiple EM for Motif Elicitation. Text file only
enetnglyc Reports N-glycosylation sites in human proteins
enetphos Reports ser, thr and tyr phosphorylation sites in eukaryotic proteins
epestfind Finds PEST motifs as potential proteolytic cleavage sites
eprop Reports propeptide cleavage sites in proteins
esignalp Reports protein signal cleavage sites
etmhmm Reports transmembrane helices
eyinoyang Reports O-(beta)-GlcNAc attachment sites
fuzzpro Search for patterns in protein sequences
fuzztran Search for patterns in protein sequences (translated)
helixturnhelix Identify nucleic acid-binding motifs in protein sequences
oddcomp Identify proteins with specified sequence word composition
omeme Motif detection
patmatdb Searches protein sequences with a sequence motif
patmatmotifs Scan a protein sequence with motifs from the PROSITE database
pepcoil Predicts coiled coil regions in protein sequences
preg Regular expression search of protein sequence(s)
pscan Scans protein sequence(s) with fingerprints from the PRINTS database
sigcleave Reports on signal cleavage sites in a protein sequence

Author(s)

This program is an EMBOSS wrapper for a program written by the CBS group http://www.cbs.dtu.dk/index.shtml

The original CBS group application must be licensed and installed to use this wrapper.

Although we take every care to ensure that the results of the EMBOSS version are identical to those from the original package, we recommend that you check your inputs give the same results in both versions before publication.

Please report all bugs in the EMBOSS version to the EMBOSS bug team, not to the original author.

History

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments

None