eprop

 

Wiki

The master copies of EMBOSS documentation are available at http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

Please help by correcting and extending the Wiki pages.

Function

Reports propeptide cleavage sites in proteins

Description

ProP 1.0 server predicts arginine and lysine propeptide cleavage sites in eukaryotic protein sequences using an ensemble of neural networks. Furin-specific prediction is the default. It is also possible to perform a general proprotein convertase (PC) prediction.

Usage

Here is a sample session with eprop


% eprop 
Reports propeptide cleavage sites in proteins
Input (aligned) sequence set: EDA_HUMAN.fsa
Output file [eda_human.eprop]: 

Go to the input files for this example
Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          seqset     (Aligned) sequence set filename and optional
                                  format, or reference (input USA)
  [-outfile]           outfile    [*.eprop] Output file name

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers:
   -plot               boolean    [N] Produce graphics
   -pcprediction       boolean    [N] Perform proprotein convertase prediction
   -signalp            boolean    [N] Include signal peptide cleavage site
                                  prediction

   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-outfile" associated qualifiers
   -odirectory2        string     Output directory

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages

Qualifier Type Description Allowed values Default
Standard (Mandatory) qualifiers
[-sequence]
(Parameter 1)
seqset (Aligned) sequence set filename and optional format, or reference (input USA) Readable set of sequences Required
[-outfile]
(Parameter 2)
outfile Output file name Output file <*>.eprop
Additional (Optional) qualifiers
(none)
Advanced (Unprompted) qualifiers
-plot boolean Produce graphics Boolean value Yes/No No
-pcprediction boolean Perform proprotein convertase prediction Boolean value Yes/No No
-signalp boolean Include signal peptide cleavage site prediction Boolean value Yes/No No

Input file format

eprop reads any normal sequence USAs.

Input files for usage example

File: EDA_HUMAN.fsa

>EDA_HUMAN   Q92838 Ectodysplasin A (Ectodermal dysplasia protein) (EDA protein). - Homo sapiens (Human).
MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCC
YLELRSELRRERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGE
AALHSDSQDGHQMALLNFFFPDEKPYSEEESRRVRRNKRSKSNEGADGPVKNKKKGKKAG
PPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADK
AGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGT
YFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKI
AVKMVHADISINMSKHTTFFGAIRLGEAPAS

Output file format

Output files for usage example

File: eda_human.eprop



         ##### ProP v.1.0b ProPeptide Cleavage Site Prediction #####


         ##### Furin-type cleavage site prediction (Arginine/Lysine residues) #####


  391 EDA_HUMAN   
MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCCYLELRSELRRERGAESRLGG      80
SGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGEAALHSDSQDGHQMALLNFFFPDEKPYSEEESRRVRRNKRS     160
KSNEGADGPVKNKKKGKKAGPPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADK     240
AGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASY     320
EVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS              400
................................................................................      80
..............................................................................P.     160
................................................................................     240
................................................................................     320
.......................................................................              400
 
Propeptide cleavage sites predicted:	Arg(R)/Lys(K): 1




Name           Pos    Context     Score  Pred
____________________________v_________________
EDA_HUMAN        8    GYPEVER|RE  0.057    .
EDA_HUMAN        9    YPEVERR|EL  0.128    .
EDA_HUMAN       18    LPAAAPR|ER  0.135    .
EDA_HUMAN       20    AAAPRER|GS  0.102    .
EDA_HUMAN       33    CGGAPAR|AG  0.090    .
EDA_HUMAN       65    CCYLELR|SE  0.089    .
EDA_HUMAN       69    ELRSELR|RE  0.081    .
EDA_HUMAN       70    LRSELRR|ER  0.195    .
EDA_HUMAN       72    SELRRER|GA  0.293    .
EDA_HUMAN       77    ERGAESR|LG  0.112    .
EDA_HUMAN      112    LGQPSPK|QQ  0.064    .
EDA_HUMAN      144    FFFPDEK|PY  0.060    .
EDA_HUMAN      152    YSEEESR|RV  0.096    .
EDA_HUMAN      153    SEEESRR|VR  0.114    .
EDA_HUMAN      155    EESRRVR|RN  0.204    .
EDA_HUMAN      156    ESRRVRR|NK  0.482    .
EDA_HUMAN      158    RRVRRNK|RS  0.182    .
EDA_HUMAN      159    RVRRNKR|SK  0.819 *ProP*
EDA_HUMAN      161    RRNKRSK|SN  0.131    .
EDA_HUMAN      171    GADGPVK|NK  0.060    .
EDA_HUMAN      173    DGPVKNK|KK  0.066    .
EDA_HUMAN      174    GPVKNKK|KG  0.119    .
EDA_HUMAN      175    PVKNKKK|GK  0.156    .
EDA_HUMAN      177    KNKKKGK|KA  0.116    .
EDA_HUMAN      178    NKKKGKK|AG  0.120    .
EDA_HUMAN      240    PSGAADK|AG  0.060    .
EDA_HUMAN      244    ADKAGTR|EN  0.082    .
EDA_HUMAN      263    GSAIQVK|ND  0.066    .
EDA_HUMAN      276    VLNDWSR|IT  0.077    .
EDA_HUMAN      282    RITMNPK|VF  0.057    .
EDA_HUMAN      285    MNPKVFK|LH  0.064    .
EDA_HUMAN      289    VFKLHPR|SG  0.116    .
EDA_HUMAN      327    EVVVDEK|PF  0.060    .
EDA_HUMAN      334    PFLQCTR|SI  0.152    .
EDA_HUMAN      340    RSIETGK|TN  0.061    .
EDA_HUMAN      355    AGVCLLK|AR  0.059    .
EDA_HUMAN      357    VCLLKAR|QK  0.099    .
EDA_HUMAN      359    LLKARQK|IA  0.073    .
EDA_HUMAN      363    RQKIAVK|MV  0.078    .
EDA_HUMAN      375    ISINMSK|HT  0.067    .
EDA_HUMAN      384    TFFGAIR|LG  0.076    .
____________________________^_________________




Data files

None.

Notes

None.

References

None.

Warnings

None.

Diagnostic Error Messages

None.

Exit status

It always exits with status 0.

Known bugs

None.

See also

Program name Description
antigenic Finds antigenic sites in proteins
digest Reports on protein proteolytic enzyme or reagent cleavage sites
echlorop Reports presence of chloroplast transit peptides
eiprscan Motif detection
elipop Prediction of lipoproteins
emast Motif detection
ememe Multiple EM for Motif Elicitation
ememetext Multiple EM for Motif Elicitation. Text file only
enetnglyc Reports N-glycosylation sites in human proteins
enetoglyc Reports mucin type GalNAc O-glycosylation sites in mammalian proteins
enetphos Reports ser, thr and tyr phosphorylation sites in eukaryotic proteins
epestfind Finds PEST motifs as potential proteolytic cleavage sites
esignalp Reports protein signal cleavage sites
etmhmm Reports transmembrane helices
eyinoyang Reports O-(beta)-GlcNAc attachment sites
fuzzpro Search for patterns in protein sequences
fuzztran Search for patterns in protein sequences (translated)
helixturnhelix Identify nucleic acid-binding motifs in protein sequences
oddcomp Identify proteins with specified sequence word composition
omeme Motif detection
patmatdb Searches protein sequences with a sequence motif
patmatmotifs Scan a protein sequence with motifs from the PROSITE database
pepcoil Predicts coiled coil regions in protein sequences
preg Regular expression search of protein sequence(s)
pscan Scans protein sequence(s) with fingerprints from the PRINTS database
sigcleave Reports on signal cleavage sites in a protein sequence

Author(s)

This program is an EMBOSS wrapper for a program written by the CBS group http://www.cbs.dtu.dk/index.shtml

The original CBS group application must be licensed and installed to use this wrapper.

Although we take every care to ensure that the results of the EMBOSS version are identical to those from the original package, we recommend that you check your inputs give the same results in both versions before publication.

Please report all bugs in the EMBOSS version to the EMBOSS bug team, not to the original author.

History

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments

None