|
|
esignalp |
Please help by correcting and extending the Wiki pages.
% esignalp
Reports protein signal cleavage sites
Input (aligned) sequence set: test.seq
Organism
euk : euk
gramp : gram positive
gramn : gram negative
Organism type to use [euk]:
Algorithm method
nn+hmm : Neural net plus hmm
nn : Neural net
hmm : Hmm
Method to use [nn+hmm]:
Text output format
full : Full
summary : Summary
short : Short
Output format [full]:
Graphics mode
none : none
gif : gif
eps : eps
gif+eps : gif+eps
ps : ps
Graphics output [none]:
1.0 : 1.0
1.1 : 1.1
2.0 : 2.0
3.0 : 3.0
Signalp version weights [3.0]:
Output file [test.esignalp]:
|
Go to the input files for this example
Go to the output files for this example
Standard (Mandatory) qualifiers:
[-sequence] seqset (Aligned) sequence set filename and optional
format, or reference (input USA)
-type menu [euk] Organism type to use (Values: euk
(euk); gramp (gram positive); gramn (gram
negative))
-method menu [nn+hmm] Method to use (Values: nn+hmm
(Neural net plus hmm); nn (Neural net); hmm
(Hmm))
-format menu [full] Output format (Values: full (Full);
summary (Summary); short (Short))
-gmode menu [none] Graphics output (Values: none (none);
gif (gif); eps (eps); gif+eps (gif+eps); ps
(ps))
-synver menu [3.0] Signalp version weights (Values: 1.0
(1.0); 1.1 (1.1); 2.0 (2.0); 3.0 (3.0))
[-outfile] outfile [*.esignalp] Output file name
Additional (Optional) qualifiers: (none)
Advanced (Unprompted) qualifiers:
-truncate integer [0] Truncate sequence to n N-terminal
residues (0=off) (Integer 0 or more)
-keepall boolean [N] Keep all gnuplot files
Associated qualifiers:
"-sequence" associated qualifiers
-sbegin1 integer Start of each sequence to be used
-send1 integer End of each sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-sformat1 string Input sequence format
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-outfile" associated qualifiers
-odirectory2 string Output directory
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write first file to standard output
-filter boolean Read first file from standard input, write
first file to standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
|
| Qualifier | Type | Description | Allowed values | Default | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Standard (Mandatory) qualifiers | ||||||||||||||
| [-sequence] (Parameter 1) |
seqset | (Aligned) sequence set filename and optional format, or reference (input USA) | Readable set of sequences | Required | ||||||||||
| -type | list | Organism type to use |
|
euk | ||||||||||
| -method | list | Method to use |
|
nn+hmm | ||||||||||
| -format | list | Output format |
|
full | ||||||||||
| -gmode | list | Graphics output |
|
none | ||||||||||
| -synver | list | Signalp version weights |
|
3.0 | ||||||||||
| [-outfile] (Parameter 2) |
outfile | Output file name | Output file | <*>.esignalp | ||||||||||
| Additional (Optional) qualifiers | ||||||||||||||
| (none) | ||||||||||||||
| Advanced (Unprompted) qualifiers | ||||||||||||||
| -truncate | integer | Truncate sequence to n N-terminal residues (0=off) | Integer 0 or more | 0 | ||||||||||
| -keepall | boolean | Keep all gnuplot files | Boolean value Yes/No | No | ||||||||||
>14KD_DAUCA MGSKNSASVALFFTLNILFFALVSSTEKCPDPYKPKPKPTPKPTPTPYPSAGKCPRDALK LGVCADVLNL |
*********************** SignalP 3.0 predictions ***********************
Using neural networks (NN) and hidden Markov models (HMM) trained on eukaryotes
----------------------------------------------------------------------
>14KD_DAUCA
SignalP-NN result:
>14KD_DAUCA length = 70
# pos aa C S Y
1 M 0.008 0.666 0.000
2 G 0.008 0.759 0.000
3 S 0.008 0.594 0.000
4 K 0.008 0.583 0.000
5 N 0.008 0.652 0.000
6 S 0.008 0.700 0.000
7 A 0.008 0.662 0.000
8 S 0.008 0.861 0.000
9 V 0.008 0.859 0.000
10 A 0.008 0.891 0.000
11 L 0.008 0.895 0.000
12 F 0.011 0.628 0.000
13 F 0.008 0.916 0.000
14 T 0.008 0.922 0.000
15 L 0.009 0.837 0.000
16 N 0.008 0.910 0.000
17 I 0.009 0.969 0.024
18 L 0.009 0.982 0.038
19 F 0.010 0.965 0.051
20 F 0.013 0.958 0.067
21 A 0.028 0.925 0.110
22 L 0.049 0.906 0.158
23 V 0.026 0.925 0.123
24 S 0.023 0.919 0.121
25 S 0.049 0.924 0.188
26 T 0.681 0.826 0.731
27 E 0.304 0.350 0.511
28 K 0.054 0.291 0.214
29 C 0.178 0.070 0.381
30 P 0.029 0.041 0.150
31 D 0.063 0.032 0.211
32 P 0.009 0.017 0.077
33 Y 0.017 0.014 0.099
34 K 0.011 0.010 0.076
35 P 0.008 0.009 0.061
36 K 0.027 0.013 0.100
37 P 0.008 0.013 0.049
38 K 0.009 0.013 0.046
39 P 0.008 0.011 0.037
40 T 0.008 0.003 0.030
[Part of this file has been deleted for brevity]
26 T 0.704 0.281 0.000 0.001 0.281
27 E 0.280 0.001 0.000 0.000 0.001
28 K 0.000 0.001 0.000 0.000 0.001
29 C 0.000 0.001 0.000 0.000 0.001
30 P 0.000 0.001 0.000 0.000 0.001
31 D 0.001 0.000 0.000 0.000 0.000
32 P 0.000 0.000 0.000 0.000 0.000
33 Y 0.000 0.000 0.000 0.000 0.000
34 K 0.000 0.000 0.000 0.000 0.000
35 P 0.000 0.000 0.000 0.000 0.000
36 K 0.000 0.000 0.000 0.000 0.000
37 P 0.000 0.000 0.000 0.000 0.000
38 K 0.000 0.000 0.000 0.000 0.000
39 P 0.000 0.000 0.000 0.000 0.000
40 T 0.000 0.000 0.000 0.000 0.000
41 P 0.000 0.000 0.000 0.000 0.000
42 K 0.000 0.000 0.000 0.000 0.000
43 P 0.000 0.000 0.000 0.000 0.000
44 T 0.000 0.000 0.000 0.000 0.000
45 P 0.000 0.000 0.000 0.000 0.000
46 T 0.000 0.000 0.000 0.000 0.000
47 P 0.000 0.000 0.000 0.000 0.000
48 Y 0.000 0.000 0.000 0.000 0.000
49 P 0.000 0.000 0.000 0.000 0.000
50 S 0.000 0.000 0.000 0.000 0.000
51 A 0.000 0.000 0.000 0.000 0.000
52 G 0.000 0.000 0.000 0.000 0.000
53 K 0.000 0.000 0.000 0.000 0.000
54 C 0.000 0.000 0.000 0.000 0.000
55 P 0.000 0.000 0.000 0.000 0.000
56 R 0.000 0.000 0.000 0.000 0.000
57 D 0.000 0.000 0.000 0.000 0.000
58 A 0.000 0.000 0.000 0.000 0.000
59 L 0.000 0.000 0.000 0.000 0.000
60 K 0.000 0.000 0.000 0.000 0.000
61 L 0.000 0.000 0.000 0.000 0.000
62 G 0.000 0.000 0.000 0.000 0.000
63 V 0.000 0.000 0.000 0.000 0.000
64 C 0.000 0.000 0.000 0.000 0.000
65 A 0.000 0.000 0.000 0.000 0.000
66 D 0.000 0.000 0.000 0.000 0.000
67 V 0.000 0.000 0.000 0.000 0.000
68 L 0.000 0.000 0.000 0.000 0.000
69 N 0.000 0.000 0.000 0.000 0.000
70 L 0.000 0.000 0.000 0.000 0.000
>14KD_DAUCA
Prediction: Signal peptide
Signal peptide probability: 0.990
Signal anchor probability: 0.008
Max cleavage site probability: 0.704 between pos. 25 and 26
|
| Program name | Description |
|---|---|
| antigenic | Finds antigenic sites in proteins |
| digest | Reports on protein proteolytic enzyme or reagent cleavage sites |
| echlorop | Reports presence of chloroplast transit peptides |
| eiprscan | Motif detection |
| elipop | Prediction of lipoproteins |
| emast | Motif detection |
| ememe | Multiple EM for Motif Elicitation |
| ememetext | Multiple EM for Motif Elicitation. Text file only |
| enetnglyc | Reports N-glycosylation sites in human proteins |
| enetoglyc | Reports mucin type GalNAc O-glycosylation sites in mammalian proteins |
| enetphos | Reports ser, thr and tyr phosphorylation sites in eukaryotic proteins |
| epestfind | Finds PEST motifs as potential proteolytic cleavage sites |
| eprop | Reports propeptide cleavage sites in proteins |
| etmhmm | Reports transmembrane helices |
| eyinoyang | Reports O-(beta)-GlcNAc attachment sites |
| fuzzpro | Search for patterns in protein sequences |
| fuzztran | Search for patterns in protein sequences (translated) |
| helixturnhelix | Identify nucleic acid-binding motifs in protein sequences |
| oddcomp | Identify proteins with specified sequence word composition |
| omeme | Motif detection |
| patmatdb | Searches protein sequences with a sequence motif |
| patmatmotifs | Scan a protein sequence with motifs from the PROSITE database |
| pepcoil | Predicts coiled coil regions in protein sequences |
| preg | Regular expression search of protein sequence(s) |
| pscan | Scans protein sequence(s) with fingerprints from the PRINTS database |
| sigcleave | Reports on signal cleavage sites in a protein sequence |
The original CBS group application must be licensed and installed to use this wrapper.
Although we take every care to ensure that the results of the EMBOSS version are identical to those from the original package, we recommend that you check your inputs give the same results in both versions before publication.
Please report all bugs in the EMBOSS version to the EMBOSS bug team, not to the original author.