|
|
etmhmm |
Please help by correcting and extending the Wiki pages.
% etmhmm Reports transmembrane helices Input (aligned) sequence set: 5h2a_crigr.fsa Output file [5h2a_crigr.etmhmm]: |
Go to the input files for this example
Go to the output files for this example
Standard (Mandatory) qualifiers:
[-sequence] seqset (Aligned) sequence set filename and optional
format, or reference (input USA)
[-outfile] outfile [*.etmhmm] Output file name
Additional (Optional) qualifiers: (none)
Advanced (Unprompted) qualifiers:
-html boolean [N] Produce html output
-short boolean [N] Produce short output
-plot boolean [N] Produce graphical output
-one boolean [N] Use version 1 model file
Associated qualifiers:
"-sequence" associated qualifiers
-sbegin1 integer Start of each sequence to be used
-send1 integer End of each sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-sformat1 string Input sequence format
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-outfile" associated qualifiers
-odirectory2 string Output directory
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write first file to standard output
-filter boolean Read first file from standard input, write
first file to standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
|
| Qualifier | Type | Description | Allowed values | Default |
|---|---|---|---|---|
| Standard (Mandatory) qualifiers | ||||
| [-sequence] (Parameter 1) |
seqset | (Aligned) sequence set filename and optional format, or reference (input USA) | Readable set of sequences | Required |
| [-outfile] (Parameter 2) |
outfile | Output file name | Output file | <*>.etmhmm |
| Additional (Optional) qualifiers | ||||
| (none) | ||||
| Advanced (Unprompted) qualifiers | ||||
| -html | boolean | Produce html output | Boolean value Yes/No | No |
| -short | boolean | Produce short output | Boolean value Yes/No | No |
| -plot | boolean | Produce graphical output | Boolean value Yes/No | No |
| -one | boolean | Use version 1 model file | Boolean value Yes/No | No |
>5H2A_CRIGR you can have comments after the ID MEILCEDNTSLSSIPNSLMQVDGDSGLYRNDFNSRDANSSDASNWTIDGENRTNLSFEGYLPPTCLSILHL QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWP LPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGVSMPIPVF GLQDDSKVFKQGSCLLADDNFVLIGSFVAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFL PQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNE HVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYKSSQLQA GQNKDSKEDAEPTDNDCSMVTLGKQQSEETCTDNINTVNEKVSCV |
# 5H2A_CRIGR Length: 471 # 5H2A_CRIGR Number of predicted TMHs: 7 # 5H2A_CRIGR Exp number of AAs in TMHs: 159.47336 # 5H2A_CRIGR Exp number, first 60 AAs: 0.01677 # 5H2A_CRIGR Total prob of N-in: 0.00629 5H2A_CRIGR TMHMM2.0 outside 1 76 5H2A_CRIGR TMHMM2.0 TMhelix 77 99 5H2A_CRIGR TMHMM2.0 inside 100 111 5H2A_CRIGR TMHMM2.0 TMhelix 112 134 5H2A_CRIGR TMHMM2.0 outside 135 148 5H2A_CRIGR TMHMM2.0 TMhelix 149 171 5H2A_CRIGR TMHMM2.0 inside 172 191 5H2A_CRIGR TMHMM2.0 TMhelix 192 214 5H2A_CRIGR TMHMM2.0 outside 215 233 5H2A_CRIGR TMHMM2.0 TMhelix 234 256 5H2A_CRIGR TMHMM2.0 inside 257 324 5H2A_CRIGR TMHMM2.0 TMhelix 325 347 5H2A_CRIGR TMHMM2.0 outside 348 356 5H2A_CRIGR TMHMM2.0 TMhelix 357 379 5H2A_CRIGR TMHMM2.0 inside 380 471 |
| Program name | Description |
|---|---|
| antigenic | Finds antigenic sites in proteins |
| digest | Reports on protein proteolytic enzyme or reagent cleavage sites |
| echlorop | Reports presence of chloroplast transit peptides |
| eiprscan | Motif detection |
| elipop | Prediction of lipoproteins |
| emast | Motif detection |
| ememe | Multiple EM for Motif Elicitation |
| ememetext | Multiple EM for Motif Elicitation. Text file only |
| enetnglyc | Reports N-glycosylation sites in human proteins |
| enetoglyc | Reports mucin type GalNAc O-glycosylation sites in mammalian proteins |
| enetphos | Reports ser, thr and tyr phosphorylation sites in eukaryotic proteins |
| epestfind | Finds PEST motifs as potential proteolytic cleavage sites |
| eprop | Reports propeptide cleavage sites in proteins |
| esignalp | Reports protein signal cleavage sites |
| eyinoyang | Reports O-(beta)-GlcNAc attachment sites |
| fuzzpro | Search for patterns in protein sequences |
| fuzztran | Search for patterns in protein sequences (translated) |
| helixturnhelix | Identify nucleic acid-binding motifs in protein sequences |
| oddcomp | Identify proteins with specified sequence word composition |
| omeme | Motif detection |
| patmatdb | Searches protein sequences with a sequence motif |
| patmatmotifs | Scan a protein sequence with motifs from the PROSITE database |
| pepcoil | Predicts coiled coil regions in protein sequences |
| preg | Regular expression search of protein sequence(s) |
| pscan | Scans protein sequence(s) with fingerprints from the PRINTS database |
| sigcleave | Reports on signal cleavage sites in a protein sequence |
The original CBS group application must be licensed and installed to use this wrapper.
Although we take every care to ensure that the results of the EMBOSS version are identical to those from the original package, we recommend that you check your inputs give the same results in both versions before publication.
Please report all bugs in the EMBOSS version to the EMBOSS bug team, not to the original author.