eyinoyang

 

Wiki

The master copies of EMBOSS documentation are available at http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

Please help by correcting and extending the Wiki pages.

Function

Reports O-(beta)-GlcNAc attachment sites

Description

The YinOYang WWW server produces neural network predictions for O-ß-GlcNAc attachment sites in eukaryotic protein sequences. This server can also use NetPhos, to mark possible phosphorylated sites and hence identify "Yin-Yang" sites.

Usage

Here is a sample session with eyinoyang


% eyinoyang 
Reports O-(beta)-GlcNAc attachment sites
Input (aligned) sequence set: CBG_HUMAN.fsa
Output file [cbg_human.eyinoyang]: 

Go to the input files for this example
Go to the output files for this example

Example 2


% eyinoyang 
Reports O-(beta)-GlcNAc attachment sites
Input (aligned) sequence set: LEUK_RAT.fsa
Output file [leuk_rat.eyinoyang]: 

Go to the input files for this example
Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          seqset     (Aligned) sequence set filename and optional
                                  format, or reference (input USA)
  [-outfile]           outfile    [*.eyinoyang] Output file name

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers:
   -plot               boolean    [N] Produce graphics
   -format             menu       [short] Format (Values: short (short); long
                                  (long))
   -netphos            boolean    [N] Run netphos and predict Yin-Yang sites
   -threshold          float      [0.5] Report netphos only scores above this
                                  value (Number from 0.000 to 1.000)

   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-outfile" associated qualifiers
   -odirectory2        string     Output directory

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages

Qualifier Type Description Allowed values Default
Standard (Mandatory) qualifiers
[-sequence]
(Parameter 1)
seqset (Aligned) sequence set filename and optional format, or reference (input USA) Readable set of sequences Required
[-outfile]
(Parameter 2)
outfile Output file name Output file <*>.eyinoyang
Additional (Optional) qualifiers
(none)
Advanced (Unprompted) qualifiers
-plot boolean Produce graphics Boolean value Yes/No No
-format list Format
short (short)
long (long)
short
-netphos boolean Run netphos and predict Yin-Yang sites Boolean value Yes/No No
-threshold float Report netphos only scores above this value Number from 0.000 to 1.000 0.5

Input file format

eyinoyang reads any normal sequence USAs.

Input files for usage example

File: CBG_HUMAN.fsa

>CBG_HUMAN
MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPK
KNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSD
TSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQG
KIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTI
SYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLY
IPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDT
AGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV

Input files for usage example 2

File: LEUK_RAT.fsa

>LEUK_RAT P13838 LEUKOSIALIN PRECURSOR (LEUCOCYTE SIALOGLYCOPROTEIN) (SIALOPHORIN) (CD43) (W3/13 ANTIGEN) (FRAGMENT). - RATTUS NORVEGICUS (RAT).
WAQVVSQENLPNTMTMLPFTPNSESPSTSEALSTYSSIATVPVTEDPKESISPWGQTTAP
ASSIPLGTPELSSFFFTSAGASGNTPVPELTTSQEVSTEASLVLFPKSSGVASDPPVTIT
NPATSSAVASTSLETFKGTSAPPVTVTSSTMTSGPFVATTVSSETSGPPVTMATGSLGPS
KETHGLSATIATSSGESSSVAGGTPVFSTKISTTSTPNPITTVPPRPGSSGMLLVSMLIA
LTVVLVLVALLLLWRQRQKRRTGALTLSRGGKRNGTVDAWAGPARVPDEEATTASGSGGN
KSSGAPETDGSGQRPTLTTFFSRRKSRQGSVALEELKPGTGPNLKGEEEPLVGSEDEAVE
TPTSDGPQAKDGAAPQSL

Output file format

Output files for usage example

File: cbg_human.eyinoyang

The predictions for O-GlcNAc sites in 1 sequence


###############################################################################
Warning:   This sequence seems to contain a signal peptide !!
         Proteins with signal peptides are most probably secreted
          and are unlikely to contain an O-(beta)-GlcNAc site
  # SignalP-NN ver. 3.0 euk predictions
  # name		Cmax  pos ?  Ymax  pos ?  Smax  pos ?  Smean ?  D     ?
  CBG_HUMAN             0.645  23 Y  0.717  23 Y  0.981  13 Y  0.886 Y  0.801 Y
###############################################################################


Name:  CBG_HUMAN 	Length:  405
MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLG      80
TCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNF     160
QDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTI     240
SYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMG     320
IADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLAR     400
VMNPV                                                                                480
..............G.....................................................G...........      80
................................................................................     160
....G...........................................................................     240
................................................................G...............     320
.....................GG.........................................................     400
.....                                                                                480


----------------------------------------------------------
SeqName     Residue  O-GlcNAc  Potential  Thresh.  Thresh.
                      result                (1)      (2)
----------------------------------------------------------
CBG_HUMAN      15  S    +        0.4952    0.4560   0.5650
CBG_HUMAN      69  S    +        0.5330    0.5116   0.6400
CBG_HUMAN     165  T    +        0.5099    0.4381   0.5409
CBG_HUMAN     305  T    ++       0.5937    0.4585   0.5684
CBG_HUMAN     342  S    ++       0.4782    0.3860   0.4707
CBG_HUMAN     343  S    +        0.4153    0.4096   0.5025
----------------------------------------------------------

Output files for usage example 2

File: leuk_rat.eyinoyang

The predictions for O-GlcNAc sites in 1 sequence


Name:  LEUK_RAT 	Length:  378
WAQVVSQENLPNTMTMLPFTPNSESPSTSEALSTYSSIATVPVTEDPKESISPWGQTTAPASSIPLGTPELSSFFFTSAG      80
ASGNTPVPELTTSQEVSTEASLVLFPKSSGVASDPPVTITNPATSSAVASTSLETFKGTSAPPVTVTSSTMTSGPFVATT     160
VSSETSGPPVTMATGSLGPSKETHGLSATIATSSGESSSVAGGTPVFSTKISTTSTPNPITTVPPRPGSSGMLLVSMLIA     240
LTVVLVLVALLLLWRQRQKRRTGALTLSRGGKRNGTVDAWAGPARVPDEEATTASGSGGNKSSGAPETDGSGQRPTLTTF     320
FSRRKSRQGSVALEELKPGTGPNLKGEEEPLVGSEDEAVETPTSDGPQAKDGAAPQSL                           400
.....G.............G..G....GG...G..........G.....G......GG...GG.................      80
..........GGG...GG.........GG........G.G...GGG....G.............G.GGG...G.....G.     160
.GG..G....G...........G........GGG...G.........G.....G......GG......G...........     240
.....................G.............................GG.G............G.........G..     320
...........................................G............G.                           400


----------------------------------------------------------
SeqName     Residue  O-GlcNAc  Potential  Thresh.  Thresh.
                      result                (1)      (2)
----------------------------------------------------------
LEUK_RAT        6  S    ++       0.5334    0.4196   0.5159
LEUK_RAT       20  T    +        0.4550    0.4247   0.5229
LEUK_RAT       23  S    +++      0.6551    0.3665   0.4444
LEUK_RAT       28  T    +        0.3938    0.3852   0.4697
LEUK_RAT       29  S    +++      0.6920    0.4029   0.4935
LEUK_RAT       33  S    +        0.4933    0.4381   0.5409
LEUK_RAT       44  T    +++      0.6693    0.4165   0.5118
LEUK_RAT       50  S    +        0.3897    0.3747   0.4554
LEUK_RAT       57  T    ++       0.5390    0.4111   0.5046
LEUK_RAT       58  T    +++      0.6271    0.4053   0.4967
LEUK_RAT       62  S    +        0.4869    0.4238   0.5217
LEUK_RAT       63  S    ++       0.6100    0.4194   0.5157
LEUK_RAT       91  T    +        0.4330    0.4060   0.4977
LEUK_RAT       92  T    ++       0.4961    0.3934   0.4807
LEUK_RAT       93  S    +        0.4557    0.4124   0.5063
LEUK_RAT       97  S    +        0.4692    0.4066   0.4985
LEUK_RAT       98  T    +        0.5114    0.4222   0.5195
LEUK_RAT      108  S    +        0.4984    0.4119   0.5056
LEUK_RAT      109  S    +++      0.6209    0.3978   0.4866
LEUK_RAT      118  T    ++++     0.7542    0.4267   0.5256
LEUK_RAT      120  T    ++       0.5358    0.4281   0.5274
LEUK_RAT      124  T    +++      0.6470    0.4087   0.5013
LEUK_RAT      125  S    +++      0.7343    0.4145   0.5091
LEUK_RAT      126  S    ++       0.6243    0.4313   0.5318
LEUK_RAT      131  T    +        0.4973    0.4487   0.5552
LEUK_RAT      145  T    ++++     0.7629    0.4440   0.5489
LEUK_RAT      147  T    +++      0.6993    0.4525   0.5603
LEUK_RAT      148  S    ++       0.5850    0.4536   0.5618
LEUK_RAT      149  S    +        0.5067    0.4533   0.5614
LEUK_RAT      153  S    +        0.4848    0.4352   0.5370
LEUK_RAT      159  T    ++       0.6054    0.4765   0.5927
LEUK_RAT      162  S    ++++     0.7702    0.4242   0.5221
LEUK_RAT      163  S    +        0.4354    0.4092   0.5019
LEUK_RAT      166  S    +        0.4314    0.3751   0.4560
LEUK_RAT      171  T    +++      0.7201    0.4458   0.5513
LEUK_RAT      183  T    +        0.4774    0.4040   0.4950
LEUK_RAT      192  T    ++       0.5797    0.4320   0.5327
LEUK_RAT      193  S    +++      0.6347    0.4159   0.5110
LEUK_RAT      194  S    +        0.4443    0.3990   0.4883
LEUK_RAT      198  S    +        0.4110    0.4073   0.4994
LEUK_RAT      208  S    ++       0.5823    0.4501   0.5571
LEUK_RAT      214  T    +        0.4242    0.4092   0.5020
LEUK_RAT      221  T    ++       0.5461    0.4168   0.5122
LEUK_RAT      222  T    ++       0.6041    0.4159   0.5110
LEUK_RAT      229  S    +        0.4820    0.4089   0.5016
LEUK_RAT      262  T    ++       0.4988    0.3886   0.4742
LEUK_RAT      292  T    +        0.3937    0.3877   0.4730
LEUK_RAT      293  T    ++       0.5152    0.3967   0.4851
LEUK_RAT      295  S    +        0.4397    0.3839   0.4678
LEUK_RAT      308  T    ++       0.5271    0.3720   0.4518
LEUK_RAT      318  T    +        0.4814    0.4671   0.5800
LEUK_RAT      364  S    ++       0.5089    0.3646   0.4419
LEUK_RAT      377  S    +++      0.6489    0.3408   0.4097
----------------------------------------------------------

Data files

None.

Notes

None.

References

None.

Warnings

None.

Diagnostic Error Messages

None.

Exit status

It always exits with status 0.

Known bugs

None.

See also

Program name Description
antigenic Finds antigenic sites in proteins
digest Reports on protein proteolytic enzyme or reagent cleavage sites
echlorop Reports presence of chloroplast transit peptides
eiprscan Motif detection
elipop Prediction of lipoproteins
emast Motif detection
ememe Multiple EM for Motif Elicitation
ememetext Multiple EM for Motif Elicitation. Text file only
enetnglyc Reports N-glycosylation sites in human proteins
enetoglyc Reports mucin type GalNAc O-glycosylation sites in mammalian proteins
enetphos Reports ser, thr and tyr phosphorylation sites in eukaryotic proteins
epestfind Finds PEST motifs as potential proteolytic cleavage sites
eprop Reports propeptide cleavage sites in proteins
esignalp Reports protein signal cleavage sites
etmhmm Reports transmembrane helices
fuzzpro Search for patterns in protein sequences
fuzztran Search for patterns in protein sequences (translated)
helixturnhelix Identify nucleic acid-binding motifs in protein sequences
oddcomp Identify proteins with specified sequence word composition
omeme Motif detection
patmatdb Searches protein sequences with a sequence motif
patmatmotifs Scan a protein sequence with motifs from the PROSITE database
pepcoil Predicts coiled coil regions in protein sequences
preg Regular expression search of protein sequence(s)
pscan Scans protein sequence(s) with fingerprints from the PRINTS database
sigcleave Reports on signal cleavage sites in a protein sequence

Author(s)

This program is an EMBOSS wrapper for a program written by the CBS group http://www.cbs.dtu.dk/index.shtml

The original CBS group application must be licensed and installed to use this wrapper.

Although we take every care to ensure that the results of the EMBOSS version are identical to those from the original package, we recommend that you check your inputs give the same results in both versions before publication.

Please report all bugs in the EMBOSS version to the EMBOSS bug team, not to the original author.

History

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments

None