|
|
DOMAINALIGN documentation |
ID D1CS4A_ XX EN 1CS4 XX TY SCOP XX SI 53931 CL; 54861 FO; 55073 SF; 55074 FA; 55077 DO; 55078 SO; 39418 DD; XX CL Alpha and beta proteins (a+b) XX FO Ferredoxin-like XX SF Adenylyl and guanylyl cyclase catalytic domain XX FA Adenylyl and guanylyl cyclase catalytic domain XX DO Adenylyl cyclase VC1, domain C1a XX OS Dog (Canis familiaris) XX NC 1 XX CN [1] XX CH A CHAIN; . START; . END; // ID D1FX2A_ XX EN 1FX2 XX TY SCOP XX SI 53931 CL; 54861 FO; 55073 SF; 55074 FA; 55081 DO; 55082 SO; 39430 DD; XX CL Alpha and beta proteins (a+b) XX FO Ferredoxin-like XX SF Adenylyl and guanylyl cyclase catalytic domain XX FA Adenylyl and guanylyl cyclase catalytic domain XX DO Receptor-type monomeric adenylyl cyclase XX OS Trypanosome (Trypanosoma brucei), different isoform XX NC 1 XX CN [1] XX [Part of this file has been deleted for brevity] XX EN 4AT1 XX TY SCOP XX SI 53931 CL; 54861 FO; 54893 SF; 54894 FA; 54895 DO; 54896 SO; 39019 DD; XX CL Alpha and beta proteins (a+b) XX FO Ferredoxin-like XX SF Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain XX FA Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain XX DO Aspartate carbamoyltransferase XX OS Escherichia coli XX NC 1 XX CN [1] XX CH B CHAIN; 8 START; 100 END; // ID D4AT1D1 XX EN 4AT1 XX TY SCOP XX SI 53931 CL; 54861 FO; 54893 SF; 54894 FA; 54895 DO; 54896 SO; 39020 DD; XX CL Alpha and beta proteins (a+b) XX FO Ferredoxin-like XX SF Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain XX FA Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain XX DO Aspartate carbamoyltransferase XX OS Escherichia coli XX NC 1 XX CN [1] XX CH D CHAIN; 8 START; 100 END; // |
REMARK Output from transform REMARK STAMP Package (Russell and Barton Proteins, 14, 309-323, 1992) REMARK Domains were read from the file ./domainalign-1234567890.1234.sort REMARK Chains are labelled sequentially starting with 'A' and REMARK after the order given in the file ./domainalign-1234567890.1234.sort REMARK The domains in this file are: REMARK d4at1b1 chain A REMARK d4at1d1_1 chain B REMARK Does not include heteroatoms REMARK Does not include DNA/RNA REMARK Does not include waters ATOM 1 N GLY A 8 13.557 82.383 35.829 1.00 92.06 N ATOM 2 CA GLY A 8 14.363 82.355 34.620 1.00 92.63 C ATOM 3 C GLY A 8 14.480 83.797 34.150 1.00 91.80 C ATOM 4 O GLY A 8 13.625 84.596 34.527 1.00 93.34 O ATOM 5 N VAL A 9 15.499 84.132 33.352 1.00 90.04 N ATOM 6 CA VAL A 9 15.799 85.525 33.008 1.00 89.55 C ATOM 7 C VAL A 9 15.294 86.094 31.646 1.00 90.94 C ATOM 8 O VAL A 9 14.395 85.528 31.008 1.00 91.46 O ATOM 9 CB VAL A 9 17.381 85.731 33.167 1.00 88.13 C ATOM 10 CG1 VAL A 9 17.571 86.421 34.506 1.00 86.27 C ATOM 11 CG2 VAL A 9 18.232 84.456 33.191 1.00 86.95 C ATOM 12 N GLU A 10 15.892 87.223 31.201 1.00 89.98 N ATOM 13 CA GLU A 10 15.543 87.988 30.004 1.00 87.19 C ATOM 14 C GLU A 10 16.748 88.251 29.055 1.00 83.25 C ATOM 15 O GLU A 10 17.879 87.817 29.318 1.00 81.89 O ATOM 16 CB GLU A 10 14.876 89.324 30.474 1.00 89.77 C ATOM 17 CG GLU A 10 15.390 90.058 31.748 1.00 93.53 C ATOM 18 CD GLU A 10 16.862 90.513 31.791 1.00 96.84 C ATOM 19 OE1 GLU A 10 17.570 90.129 32.731 1.00 98.75 O ATOM 20 OE2 GLU A 10 17.306 91.258 30.905 1.00 97.00 O ATOM 21 N ALA A 11 16.471 89.023 27.987 1.00 77.76 N ATOM 22 CA ALA A 11 17.315 89.379 26.829 1.00 71.32 C ATOM 23 C ALA A 11 18.829 89.525 26.622 1.00 65.96 C ATOM 24 O ALA A 11 19.605 90.124 27.370 1.00 64.35 O ATOM 25 CB ALA A 11 16.692 90.608 26.193 1.00 70.48 C ATOM 26 N ILE A 12 19.133 88.956 25.457 1.00 62.08 N ATOM 27 CA ILE A 12 20.419 88.929 24.778 1.00 60.99 C ATOM 28 C ILE A 12 19.984 89.116 23.325 1.00 61.87 C ATOM 29 O ILE A 12 18.841 88.755 22.999 1.00 62.16 O ATOM 30 CB ILE A 12 21.198 87.545 24.850 1.00 59.43 C ATOM 31 CG1 ILE A 12 20.354 86.363 24.347 1.00 55.38 C ATOM 32 CG2 ILE A 12 21.619 87.298 26.290 1.00 59.29 C ATOM 33 CD1 ILE A 12 21.107 85.072 24.029 1.00 50.25 C ATOM 34 N LYS A 13 20.745 89.683 22.389 1.00 62.88 N ATOM 35 CA LYS A 13 20.307 89.668 20.991 1.00 63.76 C ATOM 36 C LYS A 13 21.229 88.611 20.439 1.00 63.26 C ATOM 37 O LYS A 13 22.425 88.631 20.755 1.00 63.54 O ATOM 38 CB LYS A 13 20.570 90.941 20.133 1.00 65.83 C ATOM 39 CG LYS A 13 21.100 92.232 20.765 1.00 68.73 C [Part of this file has been deleted for brevity] ATOM 675 O LYS B 94 12.693 74.657 17.434 1.00 60.00 O ATOM 676 CB LYS B 94 11.413 76.088 20.143 1.00 54.56 C ATOM 677 CG LYS B 94 10.900 77.250 20.960 1.00 56.83 C ATOM 678 CD LYS B 94 9.921 76.669 21.989 1.00 59.11 C ATOM 679 CE LYS B 94 9.042 77.715 22.639 1.00 60.10 C ATOM 680 NZ LYS B 94 9.889 78.700 23.257 1.00 64.17 N ATOM 681 N SER B 95 13.442 74.032 19.482 1.00 54.16 N ATOM 682 CA SER B 95 13.784 72.649 19.193 1.00 49.80 C ATOM 683 C SER B 95 13.766 71.902 20.529 1.00 49.50 C ATOM 684 O SER B 95 13.714 72.493 21.615 1.00 50.66 O ATOM 685 CB SER B 95 15.185 72.557 18.594 1.00 49.06 C ATOM 686 OG SER B 95 15.486 73.548 17.613 1.00 48.30 O ATOM 687 N ARG B 96 13.816 70.588 20.496 1.00 50.27 N ATOM 688 CA ARG B 96 13.866 69.769 21.692 1.00 49.58 C ATOM 689 C ARG B 96 14.838 68.645 21.293 1.00 47.31 C ATOM 690 O ARG B 96 15.004 68.412 20.086 1.00 44.69 O ATOM 691 CB ARG B 96 12.425 69.303 21.982 1.00 53.09 C ATOM 692 CG ARG B 96 12.196 68.402 23.199 1.00 58.05 C ATOM 693 CD ARG B 96 10.792 68.555 23.786 1.00 61.70 C ATOM 694 NE ARG B 96 10.616 69.893 24.352 1.00 66.11 N ATOM 695 CZ ARG B 96 9.771 70.813 23.848 1.00 69.37 C ATOM 696 NH1 ARG B 96 9.701 72.022 24.420 1.00 71.16 N ATOM 697 NH2 ARG B 96 8.986 70.556 22.788 1.00 70.99 N ATOM 698 N PRO B 97 15.590 68.000 22.196 1.00 47.31 N ATOM 699 CA PRO B 97 16.436 66.851 21.916 1.00 47.03 C ATOM 700 C PRO B 97 15.753 65.608 21.356 1.00 46.69 C ATOM 701 O PRO B 97 14.799 65.054 21.927 1.00 47.44 O ATOM 702 CB PRO B 97 17.136 66.579 23.236 1.00 48.99 C ATOM 703 CG PRO B 97 17.255 67.938 23.886 1.00 49.17 C ATOM 704 CD PRO B 97 15.866 68.471 23.557 1.00 49.45 C ATOM 705 N SER B 98 16.312 65.237 20.189 1.00 45.02 N ATOM 706 CA SER B 98 16.014 64.020 19.435 1.00 41.65 C ATOM 707 C SER B 98 17.196 63.099 19.710 1.00 39.46 C ATOM 708 O SER B 98 18.326 63.606 19.716 1.00 38.78 O ATOM 709 CB SER B 98 15.951 64.289 17.938 1.00 42.24 C ATOM 710 OG SER B 98 14.655 64.742 17.585 1.00 46.01 O ATOM 711 N LEU B 99 16.990 61.791 19.948 1.00 36.31 N ATOM 712 CA LEU B 99 18.077 60.867 20.272 1.00 33.04 C ATOM 713 C LEU B 99 19.003 60.690 19.049 1.00 33.65 C ATOM 714 O LEU B 99 18.466 60.337 17.992 1.00 35.86 O ATOM 715 CB LEU B 99 17.418 59.571 20.695 1.00 29.39 C ATOM 716 CG LEU B 99 18.124 58.647 21.688 1.00 28.47 C ATOM 717 CD1 LEU B 99 18.259 59.350 23.047 1.00 27.24 C ATOM 718 CD2 LEU B 99 17.331 57.340 21.816 1.00 25.66 C ATOM 719 N PRO B 100 20.323 60.969 19.039 1.00 33.12 N ATOM 720 CA PRO B 100 21.144 60.883 17.828 1.00 35.17 C ATOM 721 C PRO B 100 21.515 59.411 17.591 1.00 38.22 C ATOM 722 O PRO B 100 21.546 58.618 18.541 1.00 36.98 O ATOM 723 CB PRO B 100 22.316 61.774 18.141 1.00 34.28 C ATOM 724 CG PRO B 100 22.528 61.462 19.624 1.00 33.62 C ATOM 725 CD PRO B 100 21.122 61.358 20.202 1.00 31.93 C |
This directory contains output files, for example 54894.daf and 55074.daf.
# TY SCOP # XX # CL Alpha and beta proteins (a+b) # XX # FO Ferredoxin-like # XX # SF Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain # XX # FA Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain # XX # SI 54894 # XX # Number 10 20 30 40 50 d4at1b1 0 GVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPXSGEMGRKDLIKIEN 0 d4at1d1 0 GVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGXEMGRKDLIKIEN 0 # Post_similar 111111111111111111111111111111111111111111-0-111111111111 # Number 60 70 80 90 d4at1b1 0 TFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLP 0 d4at1d1 0 TFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLP 0 # Post_similar 1111111111111111111111111111111111111 |
# TY SCOP # XX # CL Alpha and beta proteins (a+b) # XX # FO Ferredoxin-like # XX # SF Adenylyl and guanylyl cyclase catalytic domain # XX # FA Adenylyl and guanylyl cyclase catalytic domain # XX # SI 55074 # XX # Number 10 20 30 40 50 d1cs4a_ 0 MMFHKIYIQKXHXDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENH 0 d1fx2a_ 0 XXNNNRAPXKEPTDPVTLIFTDIESSTALWAAXHPDLMPDAVAAHHRMVRSLIGRYK 0 # Post_similar --000000-0-0-1111111111111111111-000111111111111111111111 # Number 60 70 80 90 100 110 d1cs4a_ 0 CLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMXTXGXXXXXXXX 0 d1fx2a_ 0 CYEVKTVGDSFMIAXXXXSKXXXSPFAAVQLAQELQLCFLHXHDWGTNALDDSYREF 0 # Post_similar 11111111111111----00---111111111111111111-000-0-0-------- # Number 120 130 140 150 160 170 d1cs4a_ 0 XXXXXXXXXXXXXXXXXXXXXXXXXXXVNVNMRVGIHSGRVHXCGVLGLRKWQFDVW 0 d1fx2a_ 0 EEQRAEGECEYTPPTAHMDPEVYSRLWNGLRVRVGIHTGLCDIRHDXEXVTKGYDYY 0 # Post_similar ---------------------------011111111111111-111-0-00001111 # Number 180 190 200 210 220 d1cs4a_ 0 SNDVTLANHMEAGGKAGRIHITKATLSYLNXXXGXDYEVEPGCGGERNXAYLKEHSI 0 d1fx2a_ 0 GRTPNMAARTESVANGGQVLMTHAAYMSLSAEDRKQIDVTALXGDXVALRGXVSDPV 0 # Post_similar 111111111111111111111111111111---0-1111111-00-00-00-00111 # Number 230 240 250 d1cs4a_ 0 ETFLILXXXXXXXXXXXXXXXXXX 0 d1fx2a_ 0 KMYQLNTVPSRNFAALRLDREYFD 0 # Post_similar 111111------------------ |
REMARK Output from transform REMARK STAMP Package (Russell and Barton Proteins, 14, 309-323, 1992) REMARK Domains were read from the file ./domainalign-1234567890.1234.sort REMARK Chains are labelled sequentially starting with 'A' and REMARK after the order given in the file ./domainalign-1234567890.1234.sort REMARK The domains in this file are: REMARK d1cs4a_ chain A REMARK d1fx2a__1 chain B REMARK Does not include heteroatoms REMARK Does not include DNA/RNA REMARK Does not include waters ATOM 1 N MET A 377 28.568 -27.770 32.255 1.00 73.77 N ATOM 2 CA MET A 377 28.292 -26.443 32.794 1.00 72.28 C ATOM 3 C MET A 377 29.325 -25.377 32.396 1.00 69.48 C ATOM 4 O MET A 377 30.485 -25.687 32.098 1.00 67.04 O ATOM 5 CB MET A 377 28.075 -26.504 34.312 1.00 74.79 C ATOM 6 CG MET A 377 29.171 -27.205 35.092 1.00 78.73 C ATOM 7 SD MET A 377 28.708 -27.446 36.824 1.00 83.74 S ATOM 8 CE MET A 377 28.745 -25.745 37.440 1.00 81.94 C ATOM 9 N MET A 378 28.883 -24.120 32.395 1.00 66.44 N ATOM 10 CA MET A 378 29.698 -22.969 32.011 1.00 62.94 C ATOM 11 C MET A 378 30.928 -22.727 32.886 1.00 59.70 C ATOM 12 O MET A 378 32.059 -22.739 32.400 1.00 57.00 O ATOM 13 CB MET A 378 28.824 -21.715 31.966 1.00 64.01 C ATOM 14 CG MET A 378 27.551 -21.872 31.137 1.00 64.35 C ATOM 15 SD MET A 378 27.897 -22.219 29.403 1.00 67.83 S ATOM 16 CE MET A 378 27.844 -24.014 29.357 1.00 65.41 C ATOM 17 N PHE A 379 30.697 -22.474 34.167 1.00 56.03 N ATOM 18 CA PHE A 379 31.763 -22.225 35.123 1.00 53.16 C ATOM 19 C PHE A 379 32.157 -23.501 35.837 1.00 51.53 C ATOM 20 O PHE A 379 31.372 -24.440 35.914 1.00 53.09 O ATOM 21 CB PHE A 379 31.296 -21.227 36.186 1.00 54.14 C ATOM 22 CG PHE A 379 31.091 -19.832 35.671 1.00 51.13 C ATOM 23 CD1 PHE A 379 29.927 -19.493 34.986 1.00 50.12 C ATOM 24 CD2 PHE A 379 32.049 -18.846 35.907 1.00 49.63 C ATOM 25 CE1 PHE A 379 29.716 -18.196 34.546 1.00 51.63 C ATOM 26 CE2 PHE A 379 31.852 -17.545 35.474 1.00 50.16 C ATOM 27 CZ PHE A 379 30.682 -17.216 34.792 1.00 51.72 C ATOM 28 N HIS A 380 33.371 -23.529 36.372 1.00 50.09 N ATOM 29 CA HIS A 380 33.830 -24.687 37.120 1.00 49.62 C ATOM 30 C HIS A 380 33.046 -24.672 38.431 1.00 49.26 C ATOM 31 O HIS A 380 32.579 -23.623 38.866 1.00 50.30 O ATOM 32 CB HIS A 380 35.327 -24.574 37.439 1.00 52.29 C ATOM 33 CG HIS A 380 36.235 -24.929 36.299 1.00 53.66 C ATOM 34 ND1 HIS A 380 36.782 -23.983 35.457 1.00 53.12 N ATOM 35 CD2 HIS A 380 36.737 -26.122 35.898 1.00 52.37 C ATOM 36 CE1 HIS A 380 37.581 -24.576 34.588 1.00 50.60 C ATOM 37 NE2 HIS A 380 37.572 -25.873 34.833 1.00 52.60 N ATOM 38 N LYS A 381 32.879 -25.832 39.051 1.00 50.19 N ATOM 39 CA LYS A 381 32.167 -25.897 40.318 1.00 51.93 C [Part of this file has been deleted for brevity] ATOM 1806 CG ASP B1117 55.880 2.261 56.337 1.00 70.08 C ATOM 1807 OD1 ASP B1117 55.413 2.019 55.196 1.00 73.38 O ATOM 1808 OD2 ASP B1117 57.083 2.060 56.637 1.00 70.53 O ATOM 1809 N ARG B1118 52.763 0.078 56.474 1.00 66.61 N ATOM 1810 CA ARG B1118 52.480 -1.376 56.573 1.00 68.20 C ATOM 1811 C ARG B1118 53.211 -2.510 55.827 1.00 68.77 C ATOM 1812 O ARG B1118 54.420 -2.486 55.586 1.00 70.57 O ATOM 1813 CB ARG B1118 51.032 -1.595 56.196 1.00 71.02 C ATOM 1814 CG ARG B1118 49.987 -0.729 56.780 1.00 66.89 C ATOM 1815 CD ARG B1118 48.804 -0.984 55.854 1.00 69.79 C ATOM 1816 NE ARG B1118 47.547 -0.456 56.345 1.00 65.16 N ATOM 1817 CZ ARG B1118 47.349 0.806 56.713 1.00 67.30 C ATOM 1818 NH1 ARG B1118 48.317 1.718 56.648 1.00 62.67 N ATOM 1819 NH2 ARG B1118 46.197 1.138 57.252 1.00 60.83 N ATOM 1820 N GLU B1119 52.369 -3.489 55.467 1.00 74.62 N ATOM 1821 CA GLU B1119 52.575 -4.774 54.755 1.00 71.44 C ATOM 1822 C GLU B1119 51.215 -5.343 55.151 1.00 68.30 C ATOM 1823 O GLU B1119 50.786 -5.070 56.254 1.00 70.28 O ATOM 1824 CB GLU B1119 53.627 -5.681 55.450 1.00 72.63 C ATOM 1825 CG GLU B1119 53.055 -6.990 56.216 1.00 68.78 C ATOM 1826 CD GLU B1119 52.428 -6.727 57.621 1.00 67.37 C ATOM 1827 OE1 GLU B1119 52.887 -5.742 58.270 1.00 63.79 O ATOM 1828 OE2 GLU B1119 51.452 -7.442 58.066 1.00 24.30 O ATOM 1829 N TYR B1120 50.503 -6.072 54.309 1.00 69.56 N ATOM 1830 CA TYR B1120 49.236 -6.678 54.769 1.00 66.82 C ATOM 1831 C TYR B1120 49.095 -7.990 54.006 1.00 69.41 C ATOM 1832 O TYR B1120 49.546 -8.081 52.863 1.00 60.86 O ATOM 1833 CB TYR B1120 48.062 -5.720 54.628 1.00 64.84 C ATOM 1834 CG TYR B1120 46.959 -6.106 53.680 1.00 72.65 C ATOM 1835 CD1 TYR B1120 47.055 -5.808 52.324 1.00 69.04 C ATOM 1836 CD2 TYR B1120 45.764 -6.657 54.153 1.00 72.45 C ATOM 1837 CE1 TYR B1120 45.995 -6.037 51.460 1.00 74.31 C ATOM 1838 CE2 TYR B1120 44.687 -6.891 53.292 1.00 74.14 C ATOM 1839 CZ TYR B1120 44.814 -6.575 51.946 1.00 77.01 C ATOM 1840 OH TYR B1120 43.764 -6.790 51.086 1.00 73.74 O ATOM 1841 N PHE B1121 48.537 -9.015 54.662 1.00 67.32 N ATOM 1842 CA PHE B1121 48.400 -10.386 54.119 1.00 68.14 C ATOM 1843 C PHE B1121 48.560 -10.743 52.625 1.00 68.72 C ATOM 1844 O PHE B1121 49.617 -11.227 52.232 1.00 71.84 O ATOM 1845 CB PHE B1121 47.209 -11.122 54.716 1.00 64.05 C ATOM 1846 CG PHE B1121 47.407 -12.617 54.793 1.00 61.04 C ATOM 1847 CD1 PHE B1121 48.271 -13.163 55.733 1.00 58.84 C ATOM 1848 CD2 PHE B1121 46.736 -13.477 53.925 1.00 63.12 C ATOM 1849 CE1 PHE B1121 48.465 -14.539 55.814 1.00 60.74 C ATOM 1850 CE2 PHE B1121 46.924 -14.858 53.998 1.00 59.31 C ATOM 1851 CZ PHE B1121 47.787 -15.391 54.940 1.00 64.18 C ATOM 1852 N ASP B1122 47.527 -10.584 51.804 1.00 72.82 N ATOM 1853 CA ASP B1122 47.655 -10.919 50.373 1.00 73.64 C ATOM 1854 C ASP B1122 46.519 -10.364 49.515 1.00 74.17 C ATOM 1855 O ASP B1122 46.463 -10.760 48.331 1.00 75.01 O ATOM 1856 CB ASP B1122 47.789 -12.445 50.171 1.00 73.22 C |
Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' Replaced ' ' in STAMP alignment with 'X' |
test_data/ - .dent /data/pdb - - /data/pdb _ .ent /data/pdb _ .pdb /data/pdb pdb .ent /data/pdbscop _ _ /data/pdbscop _ .ent /data/pdbscop _ .pdb /data/pdbscop pdb .ent ./ _ _ ./ _ .ent ./ _ .ent.z ./ _ .ent.gz ./ _ .pdb ./ _ .pdb.Z ./ _ .pdb.gz ./ pdb .ent ./ pdb .ent.Z ./ pdb .ent.gz /data/CASS1/pdb/coords/ _ .pdb /data/CASS1/pdb/coords/ _ .pdb.Z /data/CASS1/pdb/coords/ _ .pdb.gz |
Standard (Mandatory) qualifiers (* if not always prompted):
[-dcfinfile] infile This option specifies the name of DCF file
(domain classification file) (input). A
'domain classification file' contains
classification and other data for domains
from SCOP or CATH, in DCF format
(EMBL-like). The files are generated by
using SCOPPARSE and CATHPARSE. Domain
sequence information can be added to the
file by using DOMAINSEQS.
[-pdbdir] directory [./] This option specifies the location of
domain PDB files (input). A 'domain PDB
file' contains coordinate data for a single
domain from SCOP or CATH, in PDB format. The
files are generated by using DOMAINER.
-node menu [1] This option specifies the node for
redundancy removal. Redundancy can be
removed at any specified node in the SCOP or
CATH hierarchies. For example by selecting
'Class' entries belonging to the same Class
will be non-redundant. (Values: 1 (Class
(SCOP)); 2 (Fold (SCOP)); 3 (Superfamily
(SCOP)); 4 (Family (SCOP)); 5 (Class
(CATH)); 6 (Architecture (CATH)); 7
(Topology (CATH)); 8 (Homologous Superfamily
(CATH)); 9 (Family (CATH)))
-mode menu [1] This option specifies the alignment
algorithm to use. (Values: 1 (STAMP); 2
(TCOFFEE))
-[no]keepsinglets toggle [Y] This option specifies whether to write
sequences of singlet families to file. If
you specify this option, the sequence for
each singlet family are written to file
(output).
[-dafoutdir] outdir [./] This option specifies the location of
DAF files (domain alignment files) (output).
A 'domain alignment file' contains a
sequence alignment of domains belonging to
the same SCOP or CATH family. The files are
in clustal format and are annotated with
domain family classification information.
The files generated by using SCOPALIGN will
contain a structure-based sequence alignment
of domains of known structure only. Such
alignments can be extended with sequence
relatives (of unknown structure) by using
SEQALIGN.
* -singletsoutdir outdir [./] This option specifies the location of
DHF files (domain hits files) for singlet
sequences (output). The singlets are written
out as a 'domain hits file' - which
contains database hits (sequences) with
domain classification information, in FASTA
format.
* -superoutdir outdir [./] This option specifies the location of
structural superimposition files (output). A
file in PDB format of the structural
superimposition is generated for each family
if the STAMP algorithm is used.
-logfile outfile [domainalign.log] This option specifies the
name of log file (output). The log file
contains messages about any errors arising
while domainalign ran.
Additional (Optional) qualifiers: (none)
Advanced (Unprompted) qualifiers: (none)
Associated qualifiers:
"-logfile" associated qualifiers
-odirectory string Output directory
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write first file to standard output
-filter boolean Read first file from standard input, write
first file to standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
| Qualifier | Type | Description | Allowed values | Default | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Standard (Mandatory) qualifiers | ||||||||||||||||||||||
| [-dcfinfile] (Parameter 1) |
infile | This option specifies the name of DCF file (domain classification file) (input). A 'domain classification file' contains classification and other data for domains from SCOP or CATH, in DCF format (EMBL-like). The files are generated by using SCOPPARSE and CATHPARSE. Domain sequence information can be added to the file by using DOMAINSEQS. | Input file | Required | ||||||||||||||||||
| [-pdbdir] (Parameter 2) |
directory | This option specifies the location of domain PDB files (input). A 'domain PDB file' contains coordinate data for a single domain from SCOP or CATH, in PDB format. The files are generated by using DOMAINER. | Directory | ./ | ||||||||||||||||||
| -node | list | This option specifies the node for redundancy removal. Redundancy can be removed at any specified node in the SCOP or CATH hierarchies. For example by selecting 'Class' entries belonging to the same Class will be non-redundant. |
|
1 | ||||||||||||||||||
| -mode | list | This option specifies the alignment algorithm to use. |
|
1 | ||||||||||||||||||
| -[no]keepsinglets | toggle | This option specifies whether to write sequences of singlet families to file. If you specify this option, the sequence for each singlet family are written to file (output). | Toggle value Yes/No | Yes | ||||||||||||||||||
| [-dafoutdir] (Parameter 3) |
outdir | This option specifies the location of DAF files (domain alignment files) (output). A 'domain alignment file' contains a sequence alignment of domains belonging to the same SCOP or CATH family. The files are in clustal format and are annotated with domain family classification information. The files generated by using SCOPALIGN will contain a structure-based sequence alignment of domains of known structure only. Such alignments can be extended with sequence relatives (of unknown structure) by using SEQALIGN. | Output directory | ./ | ||||||||||||||||||
| -singletsoutdir | outdir | This option specifies the location of DHF files (domain hits files) for singlet sequences (output). The singlets are written out as a 'domain hits file' - which contains database hits (sequences) with domain classification information, in FASTA format. | Output directory | ./ | ||||||||||||||||||
| -superoutdir | outdir | This option specifies the location of structural superimposition files (output). A file in PDB format of the structural superimposition is generated for each family if the STAMP algorithm is used. | Output directory | ./ | ||||||||||||||||||
| -logfile | outfile | This option specifies the name of log file (output). The log file contains messages about any errors arising while domainalign ran. | Output file | domainalign.log | ||||||||||||||||||
| Additional (Optional) qualifiers | ||||||||||||||||||||||
| (none) | ||||||||||||||||||||||
| Advanced (Unprompted) qualifiers | ||||||||||||||||||||||
| (none) | ||||||||||||||||||||||
% domainalign
Generate alignments (DAF file) for nodes in a DCF file.
Domain classification file: all.scop2
Domain pdb directory [./]:
Node at which to remove redundancy
1 : Class (SCOP)
2 : Fold (SCOP)
3 : Superfamily (SCOP)
4 : Family (SCOP)
5 : Class (CATH)
6 : Architecture (CATH)
7 : Topology (CATH)
8 : Homologous Superfamily (CATH)
9 : Family (CATH)
Select number. [1]: 4
Alignment algorithm option
1 : STAMP
2 : TCOFFEE
Select number. [1]: 1
Write sequences of singlet families to file. [Y]: N
Domain alignment file output directory [./]: daf
Pdb entry file output directory [./]:
Domainatrix log output file [domainalign.log]:
STAMP Structural Alignment of Multiple Proteins
by Robert B. Russell & Geoffrey J. Barton
Please cite PROTEINS, v14, 309-323, 1992
Results of scan will be written to file ./domainalign-1234567890.1234.scan
Fits = no. of fits performed, Sc = STAMP score, RMS = RMS deviation
Align = alignment length, Nfit = residues fitted, Eq. = equivalent residues
Secs = no. equiv. secondary structures, %I = seq. identity, %S = sec. str. identity
P(m) = P value (p=1/10) calculated after Murzin (1993), JMB, 230, 689-694
Domain1 Domain2 Fits Sc RMS Len1 Len2 Align Fit Eq. Secs %I %S P(m)
Scan d1cs4a_ d1cs4a_ 1 9.799 0.001 189 189 189 189 188 0 100.00 100.00 0.00e+00
Scan d1cs4a_ d1fx2a_ 1 6.522 1.343 189 235 225 135 133 0 20.30 100.00 0.00017
See the file ./domainalign-1234567890.1234.scan
stamp -l ./domainalign-1234567890.1234.dom -s -n 2 -slide 5 -prefix ./domainalign-1234567890.1234 -d ./domainalign-1234567890.1234.set
sorttrans -f ./domainalign-1234567890.1234.scan -s Sc 2.5 > ./domainalign-1234567890.1234.sort
stamp -l ./domainalign-1234567890.1234.sort -prefix ./domainalign-1234567890.1234 > ./domainalign-1234567890.1234.log
TRANSFORM R.B. Russell, 1995
Using PDB files
Files will not include heteroatoms
Files will not include DNA/RNA
Files will not include waters
All coordinates will be in file ./55074.ent
Domain 1, d1cs4a_ => to ./55074.ent (chain A)
Domain 2, d1fx2a__1 => to ./55074.ent (chain B)
POSTSTAMP, R.B. Russell 1995
New output will be in file ./domainalign-1234567890.1234.1
E1 = 3.800, E2 = 3.800
Minimum Pij set to 0.500
Reading domain descriptors/transformations from the file ./domainalign-1234567890.1234.1
Reading alignment...
Reading coordinates...
Domain 1 /homes/user/test/qa/domainer-keep2//d1cs4a_.ent d1cs4a_
all residues 189 CAs => 189 CAs in total
Transforming coordinates...
Domain 2 /homes/user/test/qa/domainer-keep2//d1fx2a_.ent d1fx2a__1
all residues 235 CAs => 235 CAs in total
Transforming coordinates...
...done.
transform -f ./domainalign-1234567890.1234.sort -g -o ./55074.ent
poststamp -f ./domainalign-1234567890.1234.1 -min 0.5
ver2hor -f ./domainalign-1234567890.1234.1.post > ./domainalign-1234567890.1234.out
STAMP Structural Alignment of Multiple Proteins
by Robert B. Russell & Geoffrey J. Barton
Please cite PROTEINS, v14, 309-323, 1992
Results of scan will be written to file ./domainalign-1234567890.1234.scan
Fits = no. of fits performed, Sc = STAMP score, RMS = RMS deviation
Align = alignment length, Nfit = residues fitted, Eq. = equivalent residues
Secs = no. equiv. secondary structures, %I = seq. identity, %S = sec. str. identity
P(m) = P value (p=1/10) calculated after Murzin (1993), JMB, 230, 689-694
Domain1 Domain2 Fits Sc RMS Len1 Len2 Align Fit Eq. Secs %I %S P(m)
Scan d4at1b1 d4at1b1 1 9.799 0.001 93 93 93 93 92 0 100.00 100.00 1.00e-92
Scan d4at1b1 d4at1d1 1 9.250 0.588 93 93 94 89 88 0 100.00 100.00 1.00e-88
See the file ./domainalign-1234567890.1234.scan
Processing node 54894
stamp -l ./domainalign-1234567890.1234.dom -s -n 2 -slide 5 -prefix ./domainalign-1234567890.1234 -d ./domainalign-1234567890.1234.set
sorttrans -f ./domainalign-1234567890.1234.scan -s Sc 2.5 > ./domainalign-1234567890.1234.sort
stamp -l ./domainalign-1234567890.1234.sort -prefix ./domainalign-1234567890.1234 > ./domainalign-1234567890.1234.log
TRANSFORM R.B. Russell, 1995
Using PDB files
Files will not include heteroatoms
Files will not include DNA/RNA
Files will not include waters
All coordinates will be in file ./54894.ent
Domain 1, d4at1b1 => to ./54894.ent (chain A)
Domain 2, d4at1d1_1 => to ./54894.ent (chain B)
POSTSTAMP, R.B. Russell 1995
New output will be in file ./domainalign-1234567890.1234.1
E1 = 3.800, E2 = 3.800
Minimum Pij set to 0.500
Reading domain descriptors/transformations from the file ./domainalign-1234567890.1234.1
Reading alignment...
Reading coordinates...
Domain 1 /homes/user/test/qa/domainer-keep2//d4at1b1.ent d4at1b1
all residues 93 CAs => 93 CAs in total
Transforming coordinates...
Domain 2 /homes/user/test/qa/domainer-keep2//d4at1d1.ent d4at1d1_1
all residues 93 CAs => 93 CAs in total
Transforming coordinates...
...done.
transform -f ./domainalign-1234567890.1234.sort -g -o ./54894.ent
poststamp -f ./domainalign-1234567890.1234.1 -min 0.5
ver2hor -f ./domainalign-1234567890.1234.1.post > ./domainalign-1234567890.1234.out
|
Go to the input files for this example
Go to the output files for this example
The following command line would achieve the same result.
domainalign /test_data/all.scop2 /test_data/ /test_data/ /test_data/domainalign -keepsinglets Y -singlets /test_data/domainalign -node 4 -mode 1 |
temp=getfile(domain[0].id,dirfile,4,OUTPUT); temp=getfile(domain[0].id,dirfile,7,OUTPUT); |
Transforming coordinates...
...done.
ver2hor -f ./domainalign-1022069396.11280.76.post > ./domainalign-1022069396.11280.out
error: something wrong with STAMP file
STAMP length is 370, Alignment length is 422
STAMP nseq is 155, Alignment nseq is 155
|
#define MAXtlen 200 #define MAXtlen 2000 |
gstamp.c : #define MAX_SEQ_LEN 10000 (was 2000) pdbseq.c : #define MAX_SEQ_LEN 10000 (was 3000) defaults.h: #define MAX_SEQ_LEN 10000 (was 8000) defaults.h: #define MAX_NSEQ 10000 (was 1000) defaults.h: #define MAX_BLOC_SEQ 5000 (was 500) dstamp.h : #define MAX_N_SEQ 10000 (was 1000) ver2hor.h : #define MAX_N_SEQ 10000 (was 1000) |
| FILE TYPE | FORMAT | DESCRIPTION | CREATED BY | SEE ALSO |
| Domain classification file (for SCOP) | DCF format (EMBL-like format for domain classification data). | Classification and other data for domains from SCOP. | SCOPPARSE | Domain sequence information can be added to the file by using DOMAINSEQS. |
| Domain classification file (for CATH) | DCF format (EMBL-like format for domain classification data). | Classification and other data for domains from CATH. | CATHPARSE | Domain sequence information can be added to the file by using DOMAINSEQS. |
| Domain PDB file | PDB format for domain coordinate data. | Coordinate data for a single domain from SCOP or CATH. | DOMAINER | N.A. |
| Domain alignment file | DAF format (clustal format with domain classification information). | Contains a sequence alignment of domains belonging to the same SCOP or CATH family. The file is annotated with domain family classification information. | DOMAINALIGN (structure-based sequence alignment of domains of known structure). | DOMAINALIGN alignments can be extended with sequence relatives (of unknown structure) to the family in question by using SEQALIGN. |
| Program name | Description |
|---|---|
| contacts | Generate intra-chain CON files from CCF files |
| domainrep | Reorder DCF file to identify representative structures |
| domainreso | Remove low resolution domains from a DCF file |
| interface | Generate inter-chain CON files from CCF files |
| libgen | Generate discriminating elements from alignments |
| matgen3d | Generate a 3D-1D scoring matrix from CCF files |
| psiphi | Calculates phi and psi torsion angles from protein coordinates |
| rocon | Generates a hits file from comparing two DHF files |
| rocplot | Performs ROC analysis on hits files |
| seqalign | Extend alignments (DAF file) with sequences (DHF file) |
| seqfraggle | Removes fragment sequences from DHF files |
| seqsearch | Generate PSI-BLAST hits (DHF file) from a DAF file |
| seqsort | Remove ambiguous classified sequences from DHF files |
| seqwords | Generates DHF files from keyword search of UniProt |
| siggen | Generates a sparse protein signature from an alignment |
| siggenlig | Generates ligand-binding signatures from a CON file |
| sigscan | Generates hits (DHF file) from a signature search |
| sigscanlig | Searches ligand-signature library & writes hits (LHF file) |
See also http://emboss.sourceforge.net/