splitsource |
Please help by correcting and extending the Wiki pages.
Split a sequence into original subsequences
% splitsource qasrswww:A01139 Split sequence(s) into original source sequences output sequence(s) [a01139.fasta]: |
Go to the input files for this example
Go to the output files for this example
Standard (Mandatory) qualifiers: [-sequence] seqall Sequence(s) filename and optional format, or reference (input USA) [-outseq] seqoutall [ |
Standard (Mandatory) qualifiers | Allowed values | Default | |
---|---|---|---|
[-sequence] (Parameter 1) |
Sequence(s) filename and optional format, or reference (input USA) | Readable sequence(s) | Required |
[-outseq] (Parameter 2) |
Sequence set(s) filename and optional format (output USA) | Writeable sequence(s) | <*>.format |
Additional (Optional) qualifiers | Allowed values | Default | |
(none) | |||
Advanced (Unprompted) qualifiers | Allowed values | Default | |
-feature | Retain feature information | Boolean value Yes/No | No |
ID A01139; SV 1; linear; unassigned DNA; PAT; PRO; 279 BP. XX AC A01139; XX DT 16-MAR-1994 (Rel. 38, Created) DT 14-FEB-2001 (Rel. 66, Last updated, Version 5) XX DE Fusion DNA (L.lactis MSP signal sequence and H.medicinalis desulfatohirudin DE coding sequence) XX KW . XX OS Lactococcus lactis OC Bacteria; Firmicutes; Lactobacillales; Streptococcaceae; Lactococcus. XX OS Hirudo medicinalis (medicinal leech) OC Eukaryota; Metazoa; Annelida; Clitellata; Hirudinida; Hirudinea; OC Arhynchobdellida; Hirudiniformes; Hirudinidae; Hirudo. XX RN [1] RP 1-279 RA Suri B., Schmitz A.; RT "Bacterial vectors."; RL Patent number EP0449770-A2/2, 02-OCT-1991. RL CIBA-GEIGY AG. XX FH Key Location/Qualifiers FH FT source 1..81 FT /organism="Lactococcus lactis" FT /focus FT /strain="LM0230" FT /mol_type="unassigned DNA" FT /db_xref="taxon:1358" FT source 82..279 FT /organism="Hirudo medicinalis" FT /mol_type="unassigned DNA" FT /db_xref="taxon:6421" FT CDS 1..279 FT /transl_table=11 FT /note="fusion of MSP signal peptide and hirudin" FT /protein_id="CAA00134.1" FT /translation="MKKKIISAILMSTVILSAAAPLSGVYAVVYTDCTESGQNLCLCEG FT SNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ" FT mat_peptide 82..279 FT /product="desulfatohirudin" FT sig_peptide 1..81 FT /product="MSP signal peptide" XX SQ Sequence 279 BP; 76 A; 66 C; 68 G; 69 T; 0 other; atgaaaaaaa agattatctc agctatttta atgtctacag tgatactttc tgctgcagcc 60 ccgttgtcag gtgtttacgc tgttgtttac accgactgca ccgaatctgg tcagaacctg 120 tgcctgtgcg aaggttctaa cgtttgcggt cagggtaaca aatgcatcct gggttctgac 180 ggtgaaaaaa accagtgcgt taccggcgaa ggtaccccga aaccgcagtc tcacaacgac 240 ggtgacttcg aagaaatccc ggaagaatac ctgcagtag 279 // |
>A01139_1_1-81 organism="Lactococcus lactis" strain="LM0230" Fusion DNA (L.lactis MSP signal sequence and H.medicinalis desulfatohirudin coding sequence) atgaaaaaaaagattatctcagctattttaatgtctacagtgatactttctgctgcagcc ccgttgtcaggtgtttacgct >A01139_2_82-279 organism="Hirudo medicinalis" Fusion DNA (L.lactis MSP signal sequence and H.medicinalis desulfatohirudin coding sequence) gttgtttacaccgactgcaccgaatctggtcagaacctgtgcctgtgcgaaggttctaac gtttgcggtcagggtaacaaatgcatcctgggttctgacggtgaaaaaaaccagtgcgtt accggcgaaggtaccccgaaaccgcagtctcacaacgacggtgacttcgaagaaatcccg gaagaatacctgcagtag |
Program name | Description |
---|---|
aligncopy | Reads and writes alignments |
aligncopypair | Reads and writes pairs from alignments |
biosed | Replace or delete sequence sections |
codcopy | Copy and reformat a codon usage table |
cutseq | Removes a section from a sequence |
degapseq | Removes non-alphabetic (e.g. gap) characters from sequences |
descseq | Alter the name or description of a sequence |
entret | Retrieves sequence entries from flatfile databases and files |
extractalign | Extract regions from a sequence alignment |
extractfeat | Extract features from sequence(s) |
extractseq | Extract regions from a sequence |
featcopy | Reads and writes a feature table |
featreport | Reads and writes a feature table |
listor | Write a list file of the logical OR of two sets of sequences |
makenucseq | Create random nucleotide sequences |
makeprotseq | Create random protein sequences |
maskambignuc | Masks all ambiguity characters in nucleotide sequences with N |
maskambigprot | Masks all ambiguity characters in protein sequences with X |
maskfeat | Write a sequence with masked features |
maskseq | Write a sequence with masked regions |
newseq | Create a sequence file from a typed-in sequence |
nohtml | Remove mark-up (e.g. HTML tags) from an ASCII text file |
noreturn | Remove carriage return from ASCII files |
nospace | Remove all whitespace from an ASCII text file |
notab | Replace tabs with spaces in an ASCII text file |
notseq | Write to file a subset of an input stream of sequences |
nthseq | Write to file a single sequence from an input stream of sequences |
nthseqset | Reads and writes (returns) one set of sequences from many |
pasteseq | Insert one sequence into another |
revseq | Reverse and complement a nucleotide sequence |
seqret | Reads and writes (returns) sequences |
seqretsetall | Reads and writes (returns) many sets of sequences |
seqretsplit | Reads sequences and writes them to individual files |
sizeseq | Sort sequences by size |
skipredundant | Remove redundant sequences from an input set |
skipseq | Reads and writes (returns) sequences, skipping first few |
splitter | Split sequence(s) into smaller sequences |
trimest | Remove poly-A tails from nucleotide sequences |
trimseq | Remove unwanted characters from start and end of sequence(s) |
trimspace | Remove extra whitespace from an ASCII text file |
union | Concatenate multiple sequences into a single sequence |
vectorstrip | Removes vectors from the ends of nucleotide sequence(s) |
yank | Add a sequence reference (a full USA) to a list file |