eyinoyang |
Please help by correcting and extending the Wiki pages.
% eyinoyang Reports O-(beta)-GlcNAc attachment sites Input (aligned) sequence set: CBG_HUMAN.fsa Output file [cbg_human.eyinoyang]: |
Go to the input files for this example
Go to the output files for this example
Example 2
% eyinoyang Reports O-(beta)-GlcNAc attachment sites Input (aligned) sequence set: LEUK_RAT.fsa Output file [leuk_rat.eyinoyang]: |
Go to the input files for this example
Go to the output files for this example
Reports O-(beta)-GlcNAc attachment sites Version: EMBOSS:6.2.0 Standard (Mandatory) qualifiers: [-sequence] seqset (Aligned) sequence set filename and optional format, or reference (input USA) [-outfile] outfile [*.eyinoyang] Output file name Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: -plot boolean [N] Produce graphics -format menu [short] Format (Values: short (short); long (long)) -netphos boolean [N] Run netphos and predict Yin-Yang sites -threshold float [0.5] Report netphos only scores above this value (Number from 0.000 to 1.000) Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -odirectory2 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write first file to standard output -filter boolean Read first file from standard input, write first file to standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messages -version boolean Report version number and exit |
Qualifier | Type | Description | Allowed values | Default | ||||
---|---|---|---|---|---|---|---|---|
Standard (Mandatory) qualifiers | ||||||||
[-sequence] (Parameter 1) |
seqset | (Aligned) sequence set filename and optional format, or reference (input USA) | Readable set of sequences | Required | ||||
[-outfile] (Parameter 2) |
outfile | Output file name | Output file | <*>.eyinoyang | ||||
Additional (Optional) qualifiers | ||||||||
(none) | ||||||||
Advanced (Unprompted) qualifiers | ||||||||
-plot | boolean | Produce graphics | Boolean value Yes/No | No | ||||
-format | list | Format |
|
short | ||||
-netphos | boolean | Run netphos and predict Yin-Yang sites | Boolean value Yes/No | No | ||||
-threshold | float | Report netphos only scores above this value | Number from 0.000 to 1.000 | 0.5 | ||||
Associated qualifiers | ||||||||
"-sequence" associated seqset qualifiers | ||||||||
-sbegin1 -sbegin_sequence |
integer | Start of each sequence to be used | Any integer value | 0 | ||||
-send1 -send_sequence |
integer | End of each sequence to be used | Any integer value | 0 | ||||
-sreverse1 -sreverse_sequence |
boolean | Reverse (if DNA) | Boolean value Yes/No | N | ||||
-sask1 -sask_sequence |
boolean | Ask for begin/end/reverse | Boolean value Yes/No | N | ||||
-snucleotide1 -snucleotide_sequence |
boolean | Sequence is nucleotide | Boolean value Yes/No | N | ||||
-sprotein1 -sprotein_sequence |
boolean | Sequence is protein | Boolean value Yes/No | N | ||||
-slower1 -slower_sequence |
boolean | Make lower case | Boolean value Yes/No | N | ||||
-supper1 -supper_sequence |
boolean | Make upper case | Boolean value Yes/No | N | ||||
-sformat1 -sformat_sequence |
string | Input sequence format | Any string | |||||
-sdbname1 -sdbname_sequence |
string | Database name | Any string | |||||
-sid1 -sid_sequence |
string | Entryname | Any string | |||||
-ufo1 -ufo_sequence |
string | UFO features | Any string | |||||
-fformat1 -fformat_sequence |
string | Features format | Any string | |||||
-fopenfile1 -fopenfile_sequence |
string | Features file name | Any string | |||||
"-outfile" associated outfile qualifiers | ||||||||
-odirectory2 -odirectory_outfile |
string | Output directory | Any string | |||||
General qualifiers | ||||||||
-auto | boolean | Turn off prompts | Boolean value Yes/No | N | ||||
-stdout | boolean | Write first file to standard output | Boolean value Yes/No | N | ||||
-filter | boolean | Read first file from standard input, write first file to standard output | Boolean value Yes/No | N | ||||
-options | boolean | Prompt for standard and additional values | Boolean value Yes/No | N | ||||
-debug | boolean | Write debug output to program.dbg | Boolean value Yes/No | N | ||||
-verbose | boolean | Report some/full command line options | Boolean value Yes/No | Y | ||||
-help | boolean | Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose | Boolean value Yes/No | N | ||||
-warning | boolean | Report warnings | Boolean value Yes/No | Y | ||||
-error | boolean | Report errors | Boolean value Yes/No | Y | ||||
-fatal | boolean | Report fatal errors | Boolean value Yes/No | Y | ||||
-die | boolean | Report dying program messages | Boolean value Yes/No | Y | ||||
-version | boolean | Report version number and exit | Boolean value Yes/No | N |
>CBG_HUMAN MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPK KNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSD TSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQG KIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTI SYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLY IPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDT AGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV |
>LEUK_RAT P13838 LEUKOSIALIN PRECURSOR (LEUCOCYTE SIALOGLYCOPROTEIN) (SIALOPHORIN) (CD43) (W3/13 ANTIGEN) (FRAGMENT). - RATTUS NORVEGICUS (RAT). WAQVVSQENLPNTMTMLPFTPNSESPSTSEALSTYSSIATVPVTEDPKESISPWGQTTAP ASSIPLGTPELSSFFFTSAGASGNTPVPELTTSQEVSTEASLVLFPKSSGVASDPPVTIT NPATSSAVASTSLETFKGTSAPPVTVTSSTMTSGPFVATTVSSETSGPPVTMATGSLGPS KETHGLSATIATSSGESSSVAGGTPVFSTKISTTSTPNPITTVPPRPGSSGMLLVSMLIA LTVVLVLVALLLLWRQRQKRRTGALTLSRGGKRNGTVDAWAGPARVPDEEATTASGSGGN KSSGAPETDGSGQRPTLTTFFSRRKSRQGSVALEELKPGTGPNLKGEEEPLVGSEDEAVE TPTSDGPQAKDGAAPQSL |
The predictions for O-GlcNAc sites in 1 sequence ############################################################################### Warning: This sequence seems to contain a signal peptide !! Proteins with signal peptides are most probably secreted and are unlikely to contain an O-(beta)-GlcNAc site # SignalP-NN ver. 3.0 euk predictions # name Cmax pos ? Ymax pos ? Smax pos ? Smean ? D ? CBG_HUMAN 0.645 23 Y 0.717 23 Y 0.981 13 Y 0.886 Y 0.801 Y ############################################################################### Name: CBG_HUMAN Length: 405 MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLG 80 TCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNF 160 QDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTI 240 SYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMG 320 IADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLAR 400 VMNPV 480 ..............G.....................................................G........... 80 ................................................................................ 160 ....G........................................................................... 240 ................................................................G............... 320 .....................GG......................................................... 400 ..... 480 ---------------------------------------------------------- SeqName Residue O-GlcNAc Potential Thresh. Thresh. result (1) (2) ---------------------------------------------------------- CBG_HUMAN 15 S + 0.4952 0.4560 0.5650 CBG_HUMAN 69 S + 0.5330 0.5116 0.6400 CBG_HUMAN 165 T + 0.5099 0.4381 0.5409 CBG_HUMAN 305 T ++ 0.5937 0.4585 0.5684 CBG_HUMAN 342 S ++ 0.4782 0.3860 0.4707 CBG_HUMAN 343 S + 0.4153 0.4096 0.5025 ---------------------------------------------------------- |
The predictions for O-GlcNAc sites in 1 sequence Name: LEUK_RAT Length: 378 WAQVVSQENLPNTMTMLPFTPNSESPSTSEALSTYSSIATVPVTEDPKESISPWGQTTAPASSIPLGTPELSSFFFTSAG 80 ASGNTPVPELTTSQEVSTEASLVLFPKSSGVASDPPVTITNPATSSAVASTSLETFKGTSAPPVTVTSSTMTSGPFVATT 160 VSSETSGPPVTMATGSLGPSKETHGLSATIATSSGESSSVAGGTPVFSTKISTTSTPNPITTVPPRPGSSGMLLVSMLIA 240 LTVVLVLVALLLLWRQRQKRRTGALTLSRGGKRNGTVDAWAGPARVPDEEATTASGSGGNKSSGAPETDGSGQRPTLTTF 320 FSRRKSRQGSVALEELKPGTGPNLKGEEEPLVGSEDEAVETPTSDGPQAKDGAAPQSL 400 .....G.............G..G....GG...G..........G.....G......GG...GG................. 80 ..........GGG...GG.........GG........G.G...GGG....G.............G.GGG...G.....G. 160 .GG..G....G...........G........GGG...G.........G.....G......GG......G........... 240 .....................G.............................GG.G............G.........G.. 320 ...........................................G............G. 400 ---------------------------------------------------------- SeqName Residue O-GlcNAc Potential Thresh. Thresh. result (1) (2) ---------------------------------------------------------- LEUK_RAT 6 S ++ 0.5334 0.4196 0.5159 LEUK_RAT 20 T + 0.4550 0.4247 0.5229 LEUK_RAT 23 S +++ 0.6551 0.3665 0.4444 LEUK_RAT 28 T + 0.3938 0.3852 0.4697 LEUK_RAT 29 S +++ 0.6920 0.4029 0.4935 LEUK_RAT 33 S + 0.4933 0.4381 0.5409 LEUK_RAT 44 T +++ 0.6693 0.4165 0.5118 LEUK_RAT 50 S + 0.3897 0.3747 0.4554 LEUK_RAT 57 T ++ 0.5390 0.4111 0.5046 LEUK_RAT 58 T +++ 0.6271 0.4053 0.4967 LEUK_RAT 62 S + 0.4869 0.4238 0.5217 LEUK_RAT 63 S ++ 0.6100 0.4194 0.5157 LEUK_RAT 91 T + 0.4330 0.4060 0.4977 LEUK_RAT 92 T ++ 0.4961 0.3934 0.4807 LEUK_RAT 93 S + 0.4557 0.4124 0.5063 LEUK_RAT 97 S + 0.4692 0.4066 0.4985 LEUK_RAT 98 T + 0.5114 0.4222 0.5195 LEUK_RAT 108 S + 0.4984 0.4119 0.5056 LEUK_RAT 109 S +++ 0.6209 0.3978 0.4866 LEUK_RAT 118 T ++++ 0.7542 0.4267 0.5256 LEUK_RAT 120 T ++ 0.5358 0.4281 0.5274 LEUK_RAT 124 T +++ 0.6470 0.4087 0.5013 LEUK_RAT 125 S +++ 0.7343 0.4145 0.5091 LEUK_RAT 126 S ++ 0.6243 0.4313 0.5318 LEUK_RAT 131 T + 0.4973 0.4487 0.5552 LEUK_RAT 145 T ++++ 0.7629 0.4440 0.5489 LEUK_RAT 147 T +++ 0.6993 0.4525 0.5603 LEUK_RAT 148 S ++ 0.5850 0.4536 0.5618 LEUK_RAT 149 S + 0.5067 0.4533 0.5614 LEUK_RAT 153 S + 0.4848 0.4352 0.5370 LEUK_RAT 159 T ++ 0.6054 0.4765 0.5927 LEUK_RAT 162 S ++++ 0.7702 0.4242 0.5221 LEUK_RAT 163 S + 0.4354 0.4092 0.5019 LEUK_RAT 166 S + 0.4314 0.3751 0.4560 LEUK_RAT 171 T +++ 0.7201 0.4458 0.5513 LEUK_RAT 183 T + 0.4774 0.4040 0.4950 LEUK_RAT 192 T ++ 0.5797 0.4320 0.5327 LEUK_RAT 193 S +++ 0.6347 0.4159 0.5110 LEUK_RAT 194 S + 0.4443 0.3990 0.4883 LEUK_RAT 198 S + 0.4110 0.4073 0.4994 LEUK_RAT 208 S ++ 0.5823 0.4501 0.5571 LEUK_RAT 214 T + 0.4242 0.4092 0.5020 LEUK_RAT 221 T ++ 0.5461 0.4168 0.5122 LEUK_RAT 222 T ++ 0.6041 0.4159 0.5110 LEUK_RAT 229 S + 0.4820 0.4089 0.5016 LEUK_RAT 262 T ++ 0.4988 0.3886 0.4742 LEUK_RAT 292 T + 0.3937 0.3877 0.4730 LEUK_RAT 293 T ++ 0.5152 0.3967 0.4851 LEUK_RAT 295 S + 0.4397 0.3839 0.4678 LEUK_RAT 308 T ++ 0.5271 0.3720 0.4518 LEUK_RAT 318 T + 0.4814 0.4671 0.5800 LEUK_RAT 364 S ++ 0.5089 0.3646 0.4419 LEUK_RAT 377 S +++ 0.6489 0.3408 0.4097 ---------------------------------------------------------- |
Program name | Description |
---|---|
antigenic | Finds antigenic sites in proteins |
digest | Reports on protein proteolytic enzyme or reagent cleavage sites |
echlorop | Reports presence of chloroplast transit peptides |
eiprscan | Motif detection |
elipop | Prediction of lipoproteins |
emast | Motif detection |
ememe | Multiple EM for Motif Elicitation |
ememetext | Multiple EM for Motif Elicitation. Text file only |
enetnglyc | Reports N-glycosylation sites in human proteins |
enetoglyc | Reports mucin type GalNAc O-glycosylation sites in mammalian proteins |
enetphos | Reports ser, thr and tyr phosphorylation sites in eukaryotic proteins |
epestfind | Finds PEST motifs as potential proteolytic cleavage sites |
eprop | Reports propeptide cleavage sites in proteins |
esignalp | Reports protein signal cleavage sites |
etmhmm | Reports transmembrane helices |
fuzzpro | Search for patterns in protein sequences |
fuzztran | Search for patterns in protein sequences (translated) |
helixturnhelix | Identify nucleic acid-binding motifs in protein sequences |
oddcomp | Identify proteins with specified sequence word composition |
omeme | Motif detection |
patmatdb | Searches protein sequences with a sequence motif |
patmatmotifs | Scan a protein sequence with motifs from the PROSITE database |
pepcoil | Predicts coiled coil regions in protein sequences |
preg | Regular expression search of protein sequence(s) |
pscan | Scans protein sequence(s) with fingerprints from the PRINTS database |
sigcleave | Reports on signal cleavage sites in a protein sequence |
The original CBS group application must be licensed and installed to use this wrapper.
Although we take every care to ensure that the results of the EMBOSS version are identical to those from the original package, we recommend that you check your inputs give the same results in both versions before publication.
Please report all bugs in the EMBOSS version to the EMBOSS bug team, not to the original author.