tmap

 

Wiki

The master copies of EMBOSS documentation are available at http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

Please help by correcting and extending the Wiki pages.

Function

Predict and plot transmembrane segments in protein sequences

Description

tmap predicts transmembrane segments for an aligned set of protein sequences, utilising the algorithm described in: "Persson, B. & Argos, P. (1994) Prediction of transmembrane segments in proteins utilising multiple sequence alignments J. Mol. Biol. 237, 182-192.". A plot of the propensities to form the middle and the end of transmembrane regions is output. Bars are displayed in the plot above the regions predicted as being most likely to form transmembrane regions. The transmembrane regions for the complete alignment are given first, followed by the predictions for each individual sequence in the alignment.

Usage

Here is a sample session with tmap


% tmap opsd.msf -out tmap.res -graph cps 
Predict and plot transmembrane segments in protein sequences

Created tmap.ps

Go to the input files for this example
Go to the output files for this example

Command line arguments

Predict and plot transmembrane segments in protein sequences
Version: EMBOSS:6.2.0

   Standard (Mandatory) qualifiers:
  [-sequences]         seqset     File containing a sequence alignment
   -graph              xygraph    [$EMBOSS_GRAPHICS value, or x11] Graph type
                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,
                                  tek, tekt, none, data, xterm, png, gif)
  [-outfile]           report     [*.tmap] Output report file name

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:

   "-sequences" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-graph" associated qualifiers
   -gprompt            boolean    Graph prompting
   -gdesc              string     Graph description
   -gtitle             string     Graph title
   -gsubtitle          string     Graph subtitle
   -gxtitle            string     Graph x axis title
   -gytitle            string     Graph y axis title
   -goutfile           string     Output file for non interactive displays
   -gdirectory         string     Output directory

   "-outfile" associated qualifiers
   -rformat2           string     Report format
   -rname2             string     Base file name
   -rextension2        string     File name extension
   -rdirectory2        string     Output directory
   -raccshow2          boolean    Show accession number in the report
   -rdesshow2          boolean    Show description in the report
   -rscoreshow2        boolean    Show the score in the report
   -rstrandshow2       boolean    Show the nucleotide strand in the report
   -rusashow2          boolean    Show the full USA in the report
   -rmaxall2           integer    Maximum total hits to report
   -rmaxseq2           integer    Maximum hits to report for one sequence

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options and exit. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages
   -version            boolean    Report version number and exit

Qualifier Type Description Allowed values Default
Standard (Mandatory) qualifiers
[-sequences]
(Parameter 1)
seqset File containing a sequence alignment Readable set of sequences Required
-graph xygraph Graph type EMBOSS has a list of known devices, including ps, hpgl, hp7470, hp7580, meta, cps, x11, tek, tekt, none, data, xterm, png, gif EMBOSS_GRAPHICS value, or x11
[-outfile]
(Parameter 2)
report Output report file name Report output file <*>.tmap
Additional (Optional) qualifiers
(none)
Advanced (Unprompted) qualifiers
(none)
Associated qualifiers
"-sequences" associated seqset qualifiers
-sbegin1
-sbegin_sequences
integer Start of each sequence to be used Any integer value 0
-send1
-send_sequences
integer End of each sequence to be used Any integer value 0
-sreverse1
-sreverse_sequences
boolean Reverse (if DNA) Boolean value Yes/No N
-sask1
-sask_sequences
boolean Ask for begin/end/reverse Boolean value Yes/No N
-snucleotide1
-snucleotide_sequences
boolean Sequence is nucleotide Boolean value Yes/No N
-sprotein1
-sprotein_sequences
boolean Sequence is protein Boolean value Yes/No N
-slower1
-slower_sequences
boolean Make lower case Boolean value Yes/No N
-supper1
-supper_sequences
boolean Make upper case Boolean value Yes/No N
-sformat1
-sformat_sequences
string Input sequence format Any string  
-sdbname1
-sdbname_sequences
string Database name Any string  
-sid1
-sid_sequences
string Entryname Any string  
-ufo1
-ufo_sequences
string UFO features Any string  
-fformat1
-fformat_sequences
string Features format Any string  
-fopenfile1
-fopenfile_sequences
string Features file name Any string  
"-graph" associated xygraph qualifiers
-gprompt boolean Graph prompting Boolean value Yes/No N
-gdesc string Graph description Any string  
-gtitle string Graph title Any string  
-gsubtitle string Graph subtitle Any string  
-gxtitle string Graph x axis title Any string Residue number
-gytitle string Graph y axis title Any string  
-goutfile string Output file for non interactive displays Any string tmap
-gdirectory string Output directory Any string  
"-outfile" associated report qualifiers
-rformat2
-rformat_outfile
string Report format Any string seqtable
-rname2
-rname_outfile
string Base file name Any string  
-rextension2
-rextension_outfile
string File name extension Any string  
-rdirectory2
-rdirectory_outfile
string Output directory Any string  
-raccshow2
-raccshow_outfile
boolean Show accession number in the report Boolean value Yes/No N
-rdesshow2
-rdesshow_outfile
boolean Show description in the report Boolean value Yes/No N
-rscoreshow2
-rscoreshow_outfile
boolean Show the score in the report Boolean value Yes/No Y
-rstrandshow2
-rstrandshow_outfile
boolean Show the nucleotide strand in the report Boolean value Yes/No Y
-rusashow2
-rusashow_outfile
boolean Show the full USA in the report Boolean value Yes/No N
-rmaxall2
-rmaxall_outfile
integer Maximum total hits to report Any integer value 0
-rmaxseq2
-rmaxseq_outfile
integer Maximum hits to report for one sequence Any integer value 0
General qualifiers
-auto boolean Turn off prompts Boolean value Yes/No N
-stdout boolean Write first file to standard output Boolean value Yes/No N
-filter boolean Read first file from standard input, write first file to standard output Boolean value Yes/No N
-options boolean Prompt for standard and additional values Boolean value Yes/No N
-debug boolean Write debug output to program.dbg Boolean value Yes/No N
-verbose boolean Report some/full command line options Boolean value Yes/No Y
-help boolean Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose Boolean value Yes/No N
-warning boolean Report warnings Boolean value Yes/No Y
-error boolean Report errors Boolean value Yes/No Y
-fatal boolean Report fatal errors Boolean value Yes/No Y
-die boolean Report dying program messages Boolean value Yes/No Y
-version boolean Report version number and exit Boolean value Yes/No N

Input file format

tmap reads a protein sequence USA for one or more aligned sequences.

Input files for usage example

File: opsd.msf

!!AA_MULTIPLE_ALIGNMENT 1.0

  opsd.msf MSF:  354 Type: P 15/07/06 CompCheck: 5414 ..

  Name: OPSD_HUMAN Len: 354  Check: 2647 Weight: 50.00
  Name: OPSD_XENLA Len: 354  Check: 2767 Weight: 50.00

//

           1                                               50
OPSD_HUMAN MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVL
OPSD_XENLA MNGTEGPNFYVPMSNKTGVVRSPFDYPQYYLAEPWQYSALAAYMFLLILL

           51                                             100
OPSD_HUMAN GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLH
OPSD_XENLA GLPINFMTLFVTIQHKKLRTPLNYILLNLVFANHFMVLCGFTVTMYTSMH

           101                                            150
OPSD_HUMAN GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE
OPSD_XENLA GYFIFGPTGCYIEGFFATLGGEVALWSLVVLAVERYIVVCKPMANFRFGE

           151                                            200
OPSD_HUMAN NHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNN
OPSD_XENLA NHAIMGVAFTWIMALSCAAPPLFGWSRYIPEGMQCSCGVDYYTLKPEVNN

           201                                            250
OPSD_HUMAN ESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV
OPSD_XENLA ESFVIYMFIVHFTIPLIVIFFCYGRLLCTVKEAAAQQQESLTTQKAEKEV

           251                                            300
OPSD_HUMAN TRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAI
OPSD_XENLA TRMVVIMVVFFLICWVPYAYVAFYIFTHQGSNFGPVFMTVPAFFAKSSAI

           301                                            350
OPSD_HUMAN YNPVIYIMMNKQFRNCMLTTICCGKNPLGD.DEASATVSKTETSQVAPA~
OPSD_XENLA YNPVIYIVLNKQFRNCLITTLCCGKNPFGDEDGSSAATSKTEASSVSSSQ

           351
OPSD_HUMAN ~~~~
OPSD_XENLA VSPA

Output file format

Output files for usage example

File: tmap.res

########################################
# Program: tmap
# Rundate: Fri 15 Jan 2010 12:00:00
# Commandline: tmap
#    [-sequences] ../../data/opsd.msf
#    -outfile tmap.res
#    -graph cps
# Report_format: seqtable
# Report_file: tmap.res
########################################

#=======================================
#
# Sequence: Consensus     from: 1   to: 354
# HitCount: 7
#=======================================

  Start     End TransMem Sequence
     43      70        1 YMFLLIvLGxPINFlTLyVTvQHKKLRT
     71      98        2 PLNYILLNLxxAdxFMVLxGFTxTlYTS
    112     140        3 lEGFFATLGGEiALWSLVVLAiERYvVVC
    148     176        4 FGENHAIMGVAFTWvMALaCAAPPLxGWS
    201     229        5 ESFVIYMFvVHFTIPmIiIFFCYGqLvxT
    256     276        6 IMVixFLICWVPYAxVAFYIF
    285     305        7 PiFMTiPAFFAKSaAIYNPVI

#---------------------------------------
#---------------------------------------
#=======================================
#
# Sequence: OPSD_HUMAN     from: 1   to: 354
# HitCount: 7
#=======================================

  Start     End TransMem Sequence
     43      70        1 YMFLLIVLGFPINFLTLYVTVQHKKLRT
     71      98        2 PLNYILLNLAVADLFMVLGGFTSTLYTS
    112     140        3 LEGFFATLGGEIALWSLVVLAIERYVVVC
    148     176        4 FGENHAIMGVAFTWVMALACAAPPLAGWS
    201     229        5 ESFVIYMFVVHFTIPMIIIFFCYGQLVFT
    256     276        6 IMVIAFLICWVPYASVAFYIF
    285     305        7 PIFMTIPAFFAKSAAIYNPVI

#---------------------------------------
#---------------------------------------
#=======================================
#
# Sequence: OPSD_XENLA     from: 1   to: 354
# HitCount: 7
#=======================================

  Start     End TransMem Sequence
     43      70        1 YMFLLILLGLPINFMTLFVTIQHKKLRT
     71      98        2 PLNYILLNLVFANHFMVLCGFTVTMYTS
    112     140        3 IEGFFATLGGEVALWSLVVLAVERYIVVC
    148     176        4 FGENHAIMGVAFTWIMALSCAAPPLFGWS
    201     229        5 ESFVIYMFIVHFTIPLIVIFFCYGRLLCT
    256     276        6 IMVVFFLICWVPYAYVAFYIF
    285     305        7 PVFMTVPAFFAKSSAIYNPVI

#---------------------------------------
#---------------------------------------

#---------------------------------------
# Total_sequences: 2
# Total_length: 702
# Reported_sequences: 3
# Reported_hitcount: 21
#---------------------------------------

Graphics File: tmap.ps

[tmap results]

A plot of the propensities to form the middle (solid line) and the end (dashed line) of transmembrane regions is output.

Bars are displayed in the plot above the regions predicted as being most likely to form transmembrane regions.

The text file (specified by the -outfile option) gives a summary of these regions.

The transmembrane regions for the complete alignment are given first, followed by the predictions for each individual sequence in the alignment.

Data files

None.

Notes

Two sets of transmembrane propensity values are then used for the calculations: one for the middle, hydrophobic portion and one for the terminal regions of the transmembrane sequence spans. Average propensity values are calculated for each position along the alignment, with the contribution from each sequence weighted according to its dissimilarity relative to the other aligned sequences.

Eight-residue segments are considered as potential cores of transmembrane segments and elongated if thier middle propensity values are above a threshold. End propensity values are also considered as stop signals. Only helices with a length of 15 to 29 residues are allowed and corrections for strictly conserved charged residues are made.

The method is more successful than predictions based upon single sequences alone.

References

  1. "Persson, B. & Argos, P. (1994) Prediction of transmembrane segments in proteins utilsing multiple sequence alignments J. Mol. Biol. 237, 182-192."

Warnings

None.

Diagnostic Error Messages

None.

Exit status

0 if successful.

Known bugs

None.

See also

Program name Description
garnier Predicts protein secondary structure using GOR method
helixturnhelix Identify nucleic acid-binding motifs in protein sequences
hmoment Calculate and plot hydrophobic moment for protein sequence(s)
pepcoil Predicts coiled coil regions in protein sequences
pepnet Draw a helical net for a protein sequence
pepwheel Draw a helical wheel diagram for a protein sequence

Author(s)

Original program by Bengt Persson and Patrick Argos.

This application was modified for inclusion in EMBOSS by Ian Longden (il © sanger.ac.uk)
Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UK.

History

Completed 17th June 1999.

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments

The graph y axis is not labelled. It is some kind of score, but we aer not sure exactly how to describe it.