aligncopypair

 

Wiki

The master copies of EMBOSS documentation are available at http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

Please help by correcting and extending the Wiki pages.

Function

Read and write pairs from alignments

Description

aligncopypair reads a set of aligned sequences and reports the alignment one pair at a time using any of the standard EMBOSS alignment formats.

Usage

Here is a sample session with aligncopypair


% aligncopypair 
Read and write pairs from alignments
Input (aligned) sequence set: globins.msf
Output alignment [globins.aligncopypair]: 

Go to the input files for this example
Go to the output files for this example

Command line arguments

Read and write pairs from alignments
Version: EMBOSS:6.5.0.0

   Standard (Mandatory) qualifiers:
  [-sequences]         seqset     File containing a sequence alignment.
  [-outfile]           align      [*.aligncopypair] Output alignment file name
                                  (default -aformat simple)

   Additional (Optional) qualifiers:
   -name               string     Name of the alignment (Any string)
   -comment            string     Comment on the alignment (Any string)
   -append             boolean    [N] This allows you to append the name and
                                  comments you have given on to the end of the
                                  existing alignment header.

   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:

   "-sequences" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -scircular1         boolean    Sequence is circular
   -sformat1           string     Input sequence format
   -iquery1            string     Input query fields or ID list
   -ioffset1           integer    Input start position offset
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-outfile" associated qualifiers
   -aformat2           string     Alignment format
   -aextension2        string     File name extension
   -adirectory2        string     Output directory
   -aname2             string     Base file name
   -awidth2            integer    Alignment width
   -aaccshow2          boolean    Show accession number in the header
   -adesshow2          boolean    Show description in the header
   -ausashow2          boolean    Show the full USA in the alignment
   -aglobal2           boolean    Show the full sequence in alignment

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options and exit. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages
   -version            boolean    Report version number and exit

Qualifier Type Description Allowed values Default
Standard (Mandatory) qualifiers
[-sequences]
(Parameter 1)
seqset File containing a sequence alignment. Readable set of sequences Required
[-outfile]
(Parameter 2)
align Output alignment file name (default -aformat simple) <*>.aligncopypair
Additional (Optional) qualifiers
-name string Name of the alignment Any string  
-comment string Comment on the alignment Any string  
-append boolean This allows you to append the name and comments you have given on to the end of the existing alignment header. Boolean value Yes/No No
Advanced (Unprompted) qualifiers
(none)
Associated qualifiers
"-sequences" associated seqset qualifiers
-sbegin1
-sbegin_sequences
integer Start of each sequence to be used Any integer value 0
-send1
-send_sequences
integer End of each sequence to be used Any integer value 0
-sreverse1
-sreverse_sequences
boolean Reverse (if DNA) Boolean value Yes/No N
-sask1
-sask_sequences
boolean Ask for begin/end/reverse Boolean value Yes/No N
-snucleotide1
-snucleotide_sequences
boolean Sequence is nucleotide Boolean value Yes/No N
-sprotein1
-sprotein_sequences
boolean Sequence is protein Boolean value Yes/No N
-slower1
-slower_sequences
boolean Make lower case Boolean value Yes/No N
-supper1
-supper_sequences
boolean Make upper case Boolean value Yes/No N
-scircular1
-scircular_sequences
boolean Sequence is circular Boolean value Yes/No N
-sformat1
-sformat_sequences
string Input sequence format Any string  
-iquery1
-iquery_sequences
string Input query fields or ID list Any string  
-ioffset1
-ioffset_sequences
integer Input start position offset Any integer value 0
-sdbname1
-sdbname_sequences
string Database name Any string  
-sid1
-sid_sequences
string Entryname Any string  
-ufo1
-ufo_sequences
string UFO features Any string  
-fformat1
-fformat_sequences
string Features format Any string  
-fopenfile1
-fopenfile_sequences
string Features file name Any string  
"-outfile" associated align qualifiers
-aformat2
-aformat_outfile
string Alignment format Any string simple
-aextension2
-aextension_outfile
string File name extension Any string  
-adirectory2
-adirectory_outfile
string Output directory Any string  
-aname2
-aname_outfile
string Base file name Any string  
-awidth2
-awidth_outfile
integer Alignment width Any integer value 0
-aaccshow2
-aaccshow_outfile
boolean Show accession number in the header Boolean value Yes/No N
-adesshow2
-adesshow_outfile
boolean Show description in the header Boolean value Yes/No N
-ausashow2
-ausashow_outfile
boolean Show the full USA in the alignment Boolean value Yes/No N
-aglobal2
-aglobal_outfile
boolean Show the full sequence in alignment Boolean value Yes/No N
General qualifiers
-auto boolean Turn off prompts Boolean value Yes/No N
-stdout boolean Write first file to standard output Boolean value Yes/No N
-filter boolean Read first file from standard input, write first file to standard output Boolean value Yes/No N
-options boolean Prompt for standard and additional values Boolean value Yes/No N
-debug boolean Write debug output to program.dbg Boolean value Yes/No N
-verbose boolean Report some/full command line options Boolean value Yes/No Y
-help boolean Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose Boolean value Yes/No N
-warning boolean Report warnings Boolean value Yes/No Y
-error boolean Report errors Boolean value Yes/No Y
-fatal boolean Report fatal errors Boolean value Yes/No Y
-die boolean Report dying program messages Boolean value Yes/No Y
-version boolean Report version number and exit Boolean value Yes/No N

Input file format

aligncopypair reads aligned nucleotide or protein sequences.

The input is a standard EMBOSS sequence query (also known as a 'USA').

Major sequence database sources defined as standard in EMBOSS installations include srs:embl, srs:uniprot and ensembl

Data can also be read from sequence output in any supported format written by an EMBOSS or third-party application.

The input format can be specified by using the command-line qualifier -sformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: gff (gff3), gff2, embl (em), genbank (gb, refseq), ddbj, refseqp, pir (nbrf), swissprot (swiss, sw), dasgff and debug.

See: http://emboss.sf.net/docs/themes/SequenceFormats.html for further information on sequence formats.

Input files for usage example

File: globins.msf

!!AA_MULTIPLE_ALIGNMENT 1.0

  ../data/globins.msf MSF:  164 Type: P 25/06/01 CompCheck: 4278 ..

  Name: HBB_HUMAN Len: 164  Check: 6914 Weight: 0.61
  Name: HBB_HORSE Len: 164  Check: 6007 Weight: 0.65
  Name: HBA_HUMAN Len: 164  Check: 3921 Weight: 0.65
  Name: HBA_HORSE Len: 164  Check: 4770 Weight: 0.83
  Name: MYG_PHYCA Len: 164  Check: 7930 Weight: 1.00
  Name: GLB5_PETMA Len: 164  Check: 1857 Weight: 0.91
  Name: LGB2_LUPLU Len: 164  Check: 2879 Weight: 0.43

//

           1                                               50
HBB_HUMAN  ~~~~~~~~VHLTPEEKSAVTALWGKVN.VDEVGGEALGR.LLVVYPWTQR
HBB_HORSE  ~~~~~~~~VQLSGEEKAAVLALWDKVN.EEEVGGEALGR.LLVVYPWTQR
HBA_HUMAN  ~~~~~~~~~~~~~~VLSPADKTNVKAA.WGKVGAHAGEYGAEALERMFLS
HBA_HORSE  ~~~~~~~~~~~~~~VLSAADKTNVKAA.WSKVGGHAGEYGAEALERMFLG
MYG_PHYCA  ~~~~~~~VLSEGEWQLVLHVWAKVEAD.VAGHGQDILIR.LFKSHPETLE
GLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQE
LGB2_LUPLU ~~~~~~~~GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD

           51                                             100
HBB_HUMAN  FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSE
HBB_HORSE  FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSE
HBA_HUMAN  FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD
HBA_HORSE  FPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSD
MYG_PHYCA  KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQ
GLB5_PETMA FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRD
LGB2_LUPLU LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN

           101                                            150
HBB_HUMAN  LHCDKLH..VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVA
HBB_HORSE  LHCDKLH..VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVA
HBA_HUMAN  LHAHKLR..VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVS
HBA_HORSE  LHAHKLR..VDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVS
MYG_PHYCA  SHATKHK..IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFR
GLB5_PETMA LSGKHAK..SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSA
LGB2_LUPLU LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA

           151        164
HBB_HUMAN  NALAHKYH~~~~~~
HBB_HORSE  NALAHKYH~~~~~~
HBA_HUMAN  TVLTSKYR~~~~~~
HBA_HORSE  TVLTSKYR~~~~~~
MYG_PHYCA  KDIAAKYKELGYQG
GLB5_PETMA Y~~~~~~~~~~~~~
LGB2_LUPLU IVIKKEMNDAA~~~

Output file format

The output is a standard EMBOSS alignment file.

The results can be output in one of several styles by using the command-line qualifier -aformat xxx, where 'xxx' is replaced by the name of the required format. Some of the alignment formats can cope with an unlimited number of sequences, while others are only for pairs of sequences.

The available multiple alignment format names are: multiple, simple, fasta, msf, clustal, mega, meganon, nexus,, nexusnon, phylip, phylipnon, selex, treecon, tcoffee, debug, srs.

The available pairwise alignment format names are: pair, markx0, markx1, markx2, markx3, markx10, match, sam, bam, score, srspair

See: http://emboss.sf.net/docs/themes/AlignFormats.html for further information on alignment formats.

Output files for usage example

File: globins.aligncopypair

########################################
# Program: aligncopypair
# Rundate: Sun 15 Jul 2012 12:00:00
# Commandline: aligncopypair
#    -sequences ../../data/globins.msf
# Align_format: simple
# Report_file: globins.aligncopypair
########################################

#=======================================
#
# Aligned_sequences: 2
# 1: HBB_HUMAN
# 2: HBB_HORSE
# Matrix: EBLOSUM62
#
# Length: 164
# Identity:     122/164 (74.4%)
# Similarity:   146/164 (89.0%)
# Gaps:          18/164 (11.0%)
# 
#
#=======================================

HBB_HUMAN          1 --------VHLTPEEKSAVTALWGKVN-VDEVGGEALGR-LLVVYPWTQR     40
                             |.|:.|||:||.|||.||| .:||||||||| ||||||||||
HBB_HORSE          1 --------VQLSGEEKAAVLALWDKVN-EEEVGGEALGR-LLVVYPWTQR     40

HBB_HUMAN         41 FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSE     90
                     ||:||||||.|.||||||||||||||||.:|.:|:.||||||||||.|||
HBB_HORSE         41 FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSE     90

HBB_HUMAN         91 LHCDKLH--VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVA    138
                     |||||||  ||||||||||||||.|||.||||:|||.:||:|||||||||
HBB_HORSE         91 LHCDKLH--VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVA    138

HBB_HUMAN        139 NALAHKYH------    146
                     ||||||||      
HBB_HORSE        139 NALAHKYH------    146


#=======================================
#
# Aligned_sequences: 2
# 1: HBB_HUMAN
# 2: HBA_HUMAN
# Matrix: EBLOSUM62
#
# Length: 164
# Identity:      48/164 (29.3%)


  [Part of this file has been deleted for brevity]

MYG_PHYCA          1 -------VLSEGEWQLVLHVWAKVEAD-VAGHGQDILIR-LFKSHPETLE     41
                             .:..|.|..|...:..|.: ........... :.:..|...:
LGB2_LUPLU         1 --------GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD     42

MYG_PHYCA         42 KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQ     91
                     .|...|......:...........|..|....||..:..........|..
LGB2_LUPLU        43 LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN     92

MYG_PHYCA         92 SHATKHK--IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFR    139
                     ..:....  :...:...:.|||:..:.......:..:...|...|.:...
LGB2_LUPLU        93 LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA    142

MYG_PHYCA        140 KDIAAKYKELGYQG    153
                     ..|..:..:..   
LGB2_LUPLU       143 IVIKKEMNDAA---    153


#=======================================
#
# Aligned_sequences: 2
# 1: GLB5_PETMA
# 2: LGB2_LUPLU
# Matrix: EBLOSUM62
#
# Length: 164
# Identity:      17/164 (10.4%)
# Similarity:   149/164 (90.9%)
# Gaps:          23/164 (14.0%)
# 
#
#=======================================

GLB5_PETMA         1 PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQE     50
                             ..|:.::...::|:|....:..........:......|||::
LGB2_LUPLU         1 --------GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD     42

GLB5_PETMA        51 FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRD    100
                     .|...||.:...|..............:.........:.........|::
LGB2_LUPLU        43 LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN     92

GLB5_PETMA       101 LSGKHAK--SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSA    148
                     |...|..  .........|.........|.......|...:........|
LGB2_LUPLU        93 LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA    142

GLB5_PETMA       149 Y-------------    149
                     .             
LGB2_LUPLU       143 IVIKKEMNDAA---    153


#---------------------------------------
#---------------------------------------

Data files

For protein sequences EBLOSUM62 is used for the substitution matrix. For nucleotide sequence, EDNAFULL is used.

EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by the EMBOSS environment variable EMBOSS_DATA.

To see the available EMBOSS data files, run:

% embossdata -showall

To fetch one of the data files (for example 'Exxx.dat') into your current directory for you to inspect or modify, run:


% embossdata -fetch -file Exxx.dat

Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata".

The directories are searched in the following order:

Notes

None.

References

None.

Warnings

None.

Diagnostic Error Messages

None.

Exit status

It always exits with status 0.

Known bugs

None.

See also

Program name Description
aligncopy Read and write alignments
biosed Replace or delete sequence sections
codcopy Copy and reformat a codon usage table
cutseq Remove a section from a sequence
degapseq Remove non-alphabetic (e.g. gap) characters from sequences
descseq Alter the name or description of a sequence
entret Retrieve sequence entries from flatfile databases and files
extractalign Extract regions from a sequence alignment
extractfeat Extract features from sequence(s)
extractseq Extract regions from a sequence
featcopy Read and write a feature table
featmerge Merge two overlapping feature tables
featreport Read and write a feature table
feattext Return a feature table original text
listor Write a list file of the logical OR of two sets of sequences
makenucseq Create random nucleotide sequences
makeprotseq Create random protein sequences
maskambignuc Mask all ambiguity characters in nucleotide sequences with N
maskambigprot Mask all ambiguity characters in protein sequences with X
maskfeat Write a sequence with masked features
maskseq Write a sequence with masked regions
newseq Create a sequence file from a typed-in sequence
nohtml Remove mark-up (e.g. HTML tags) from an ASCII text file
noreturn Remove carriage return from ASCII files
nospace Remove whitespace from an ASCII text file
notab Replace tabs with spaces in an ASCII text file
notseq Write to file a subset of an input stream of sequences
nthseq Write to file a single sequence from an input stream of sequences
nthseqset Read and write (return) one set of sequences from many
pasteseq Insert one sequence into another
revseq Reverse and complement a nucleotide sequence
seqcount Read and count sequences
seqret Read and write (return) sequences
seqretsetall Read and write (return) many sets of sequences
seqretsplit Read sequences and write them to individual files
sizeseq Sort sequences by size
skipredundant Remove redundant sequences from an input set
skipseq Read and write (return) sequences, skipping first few
splitsource Split sequence(s) into original source sequences
splitter Split sequence(s) into smaller sequences
trimest Remove poly-A tails from nucleotide sequences
trimseq Remove unwanted characters from start and end of sequence(s)
trimspace Remove extra whitespace from an ASCII text file
union Concatenate multiple sequences into a single sequence
vectorstrip Remove vectors from the ends of nucleotide sequence(s)
yank Add a sequence reference (a full USA) to a list file

Author(s)

Jon Ison
European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK

Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.

History

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments

None