######################################## # Program: garnier # Rundate: Fri Nov 08 15:45:27 2002 # Report_format: dbmotif # Report_file: report.dbmotif ######################################## #======================================= # # Sequence: 100K_RAT from: 1 to: 889 # HitCount: 206 # # DCH = 0, DCS = 0 # # Please cite: # Garnier, Osguthorpe and Robson (1978) J. Mol. Biol. 120:97-120 # # #======================================= Length = 6 Start = position 1 of sequence End = position 6 of sequence helix = H MMSARGDFLNY | | 1 6 Length = 1 Start = position 7 of sequence End = position 7 of sequence turns = T MSARGDFLNYA | 7 Length = 10 Start = position 8 of sequence End = position 17 of sequence helix = H SARGDFLNYALSLMRSHNDE | | 8 17 Length = 3 Start = position 18 of sequence End = position 20 of sequence coil = C LSLMRSHNDEHSD | | 18 20 Length = 5 Start = position 21 of sequence End = position 25 of sequence turns = T MRSHNDEHSDVLPVL | | 21 25 Length = 3 Start = position 26 of sequence End = position 28 of sequence sheet = E DEHSDVLPVLDVC | | 26 28 Length = 10 Start = position 29 of sequence End = position 38 of sequence helix = H SDVLPVLDVCSLKHVAYVFQ | | 29 38 Length = 2 Start = position 39 of sequence End = position 40 of sequence sheet = E SLKHVAYVFQAL || 3940 Length = 10 Start = position 41 of sequence End = position 50 of sequence helix = H KHVAYVFQALIYWIKAMNQQ | | 41 50 Length = 3 Start = position 51 of sequence End = position 53 of sequence coil = C IYWIKAMNQQTTL | | 51 53 Length = 2 Start = position 54 of sequence End = position 55 of sequence turns = T IKAMNQQTTLDT || 5455 Length = 7 Start = position 56 of sequence End = position 62 of sequence coil = C AMNQQTTLDTPQLERKR | | 56 62 Length = 15 Start = position 63 of sequence End = position 77 of sequence helix = H LDTPQLERKRTRELLELGIDNEDSE | | 63 77 Length = 1 Start = position 78 of sequence End = position 78 of sequence coil = C ELGIDNEDSEH | 78 Length = 7 Start = position 79 of sequence End = position 85 of sequence helix = H LGIDNEDSEHENDDDTS | | 79 85 Length = 3 Start = position 86 of sequence End = position 88 of sequence turns = T SEHENDDDTSQSA | | 86 88 Length = 1 Start = position 89 of sequence End = position 89 of sequence coil = C ENDDDTSQSAT | 89 Length = 2 Start = position 90 of sequence End = position 91 of sequence helix = H NDDDTSQSATLN || 9091 Length = 2 Start = position 92 of sequence End = position 93 of sequence sheet = E DDTSQSATLNDK || 9293 Length = 3 Start = position 94 of sequence End = position 96 of sequence coil = C TSQSATLNDKDDE | | 94 96 Length = 3 Start = position 97 of sequence End = position 99 of sequence turns = T SATLNDKDDESLP | | 97 99 Length = 1 Start = position 100 of sequence End = position 100 of sequence coil = C LNDKDDESLPA | 100 Length = 1 Start = position 101 of sequence End = position 101 of sequence helix = H NDKDDESLPAE | 101 Length = 2 Start = position 102 of sequence End = position 103 of sequence coil = C DKDDESLPAETG || 102103 Length = 4 Start = position 104 of sequence End = position 107 of sequence helix = H DDESLPAETGQNHP | | 104 107 Length = 2 Start = position 108 of sequence End = position 109 of sequence turns = T LPAETGQNHPFF || 108109 Length = 3 Start = position 110 of sequence End = position 112 of sequence coil = C AETGQNHPFFRRS | | 110 112 Length = 1 Start = position 113 of sequence End = position 113 of sequence turns = T GQNHPFFRRSD | 113 Length = 1 Start = position 114 of sequence End = position 114 of sequence sheet = E QNHPFFRRSDS | 114 Length = 7 Start = position 115 of sequence End = position 121 of sequence turns = T NHPFFRRSDSMTFLGCI | | 115 121 Length = 2 Start = position 122 of sequence End = position 123 of sequence sheet = E SDSMTFLGCIPP || 122123 Length = 2 Start = position 124 of sequence End = position 125 of sequence turns = T SMTFLGCIPPNP || 124125 Length = 5 Start = position 126 of sequence End = position 130 of sequence coil = C TFLGCIPPNPFEVPL | | 126 130 Length = 1 Start = position 131 of sequence End = position 131 of sequence turns = T IPPNPFEVPLA | 131 Length = 2 Start = position 132 of sequence End = position 133 of sequence sheet = E PPNPFEVPLAEA || 132133 Length = 11 Start = position 134 of sequence End = position 144 of sequence helix = H NPFEVPLAEAIPLADQPHLLQ | | 134 144 Length = 1 Start = position 145 of sequence End = position 145 of sequence coil = C PLADQPHLLQP | 145 Length = 1 Start = position 146 of sequence End = position 146 of sequence turns = T LADQPHLLQPN | 146 Length = 6 Start = position 147 of sequence End = position 152 of sequence coil = C ADQPHLLQPNARKEDL | | 147 152 Length = 2 Start = position 153 of sequence End = position 154 of sequence helix = H LQPNARKEDLFG || 153154 Length = 2 Start = position 155 of sequence End = position 156 of sequence sheet = E PNARKEDLFGRP || 155156 Length = 2 Start = position 157 of sequence End = position 158 of sequence turns = T ARKEDLFGRPSQ || 157158 Length = 3 Start = position 159 of sequence End = position 161 of sequence coil = C KEDLFGRPSQGLY | | 159 161 Length = 3 Start = position 162 of sequence End = position 164 of sequence turns = T LFGRPSQGLYSSS | | 162 164 Length = 1 Start = position 165 of sequence End = position 165 of sequence coil = C RPSQGLYSSSA | 165 Length = 2 Start = position 166 of sequence End = position 167 of sequence sheet = E PSQGLYSSSAGS || 166167 Length = 6 Start = position 168 of sequence End = position 173 of sequence turns = T QGLYSSSAGSGKCLVE | | 168 173 Length = 1 Start = position 174 of sequence End = position 174 of sequence coil = C SAGSGKCLVEV | 174 Length = 5 Start = position 175 of sequence End = position 179 of sequence sheet = E AGSGKCLVEVTMDRN | | 175 179 Length = 30 Start = position 180 of sequence End = position 209 of sequence helix = H CLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGE | | 180 209 Length = 4 Start = position 210 of sequence End = position 213 of sequence coil = C MQNRQKKAGEDQSM | | 210 213 Length = 11 Start = position 214 of sequence End = position 224 of sequence helix = H QKKAGEDQSMLAEEADSSKPG | | 214 224 Length = 1 Start = position 225 of sequence End = position 225 of sequence turns = T AEEADSSKPGP | 225 Length = 6 Start = position 226 of sequence End = position 231 of sequence coil = C EEADSSKPGPSAHDVA | | 226 231 Length = 17 Start = position 232 of sequence End = position 248 of sequence helix = H KPGPSAHDVAAQLKSSLLAEIGLTESE | | 232 248 Length = 3 Start = position 249 of sequence End = position 251 of sequence coil = C LAEIGLTESEGPP | | 249 251 Length = 2 Start = position 252 of sequence End = position 253 of sequence turns = T IGLTESEGPPLT || 252253 Length = 2 Start = position 254 of sequence End = position 255 of sequence coil = C LTESEGPPLTSF || 254255 Length = 4 Start = position 256 of sequence End = position 259 of sequence turns = T ESEGPPLTSFRPQC | | 256 259 Length = 2 Start = position 260 of sequence End = position 261 of sequence sheet = E PPLTSFRPQCSF || 260261 Length = 5 Start = position 262 of sequence End = position 266 of sequence turns = T LTSFRPQCSFMGMVI | | 262 266 Length = 3 Start = position 267 of sequence End = position 269 of sequence sheet = E PQCSFMGMVISHD | | 267 269 Length = 8 Start = position 270 of sequence End = position 277 of sequence helix = H SFMGMVISHDMLLGRWRL | | 270 277 Length = 2 Start = position 278 of sequence End = position 279 of sequence turns = T HDMLLGRWRLSL || 278279 Length = 2 Start = position 280 of sequence End = position 281 of sequence helix = H MLLGRWRLSLEL || 280281 Length = 5 Start = position 282 of sequence End = position 286 of sequence coil = C LGRWRLSLELFGRVF | | 282 286 Length = 7 Start = position 287 of sequence End = position 293 of sequence helix = H LSLELFGRVFMEDVGAE | | 287 293 Length = 6 Start = position 294 of sequence End = position 299 of sequence coil = C RVFMEDVGAEPGSILT | | 294 299 Length = 1 Start = position 300 of sequence End = position 300 of sequence turns = T VGAEPGSILTE | 300 Length = 1 Start = position 301 of sequence End = position 301 of sequence coil = C GAEPGSILTEL | 301 Length = 3 Start = position 302 of sequence End = position 304 of sequence sheet = E AEPGSILTELGGF | | 302 304 Length = 1 Start = position 305 of sequence End = position 305 of sequence helix = H GSILTELGGFE | 305 Length = 2 Start = position 306 of sequence End = position 307 of sequence coil = C SILTELGGFEVK || 306307 Length = 19 Start = position 308 of sequence End = position 326 of sequence helix = H LTELGGFEVKESKFRREMEKLRNQQSRDL | | 308 326 Length = 2 Start = position 327 of sequence End = position 328 of sequence coil = C KLRNQQSRDLSL || 327328 Length = 1 Start = position 329 of sequence End = position 329 of sequence turns = T RNQQSRDLSLE | 329 Length = 2 Start = position 330 of sequence End = position 331 of sequence coil = C NQQSRDLSLEVD || 330331 Length = 3 Start = position 332 of sequence End = position 334 of sequence sheet = E QSRDLSLEVDRDR | | 332 334 Length = 9 Start = position 335 of sequence End = position 343 of sequence helix = H DLSLEVDRDRDLLIQQTMR | | 335 343 Length = 5 Start = position 344 of sequence End = position 348 of sequence sheet = E RDLLIQQTMRQLNNH | | 344 348 Length = 1 Start = position 349 of sequence End = position 349 of sequence turns = T QQTMRQLNNHF | 349 Length = 1 Start = position 350 of sequence End = position 350 of sequence coil = C QTMRQLNNHFG | 350 Length = 9 Start = position 351 of sequence End = position 359 of sequence turns = T TMRQLNNHFGRRCATTPMA | | 351 359 Length = 2 Start = position 360 of sequence End = position 361 of sequence coil = C GRRCATTPMAVH || 360361 Length = 8 Start = position 362 of sequence End = position 369 of sequence helix = H RCATTPMAVHRVKVTFKD | | 362 369 Length = 4 Start = position 370 of sequence End = position 373 of sequence sheet = E VHRVKVTFKDEPGE | | 370 373 Length = 3 Start = position 374 of sequence End = position 376 of sequence coil = C KVTFKDEPGEGSG | | 374 376 Length = 2 Start = position 377 of sequence End = position 378 of sequence turns = T FKDEPGEGSGVA || 377378 Length = 4 Start = position 379 of sequence End = position 382 of sequence coil = C DEPGEGSGVARSFY | | 379 382 Length = 6 Start = position 383 of sequence End = position 388 of sequence sheet = E EGSGVARSFYTAIAQA | | 383 388 Length = 7 Start = position 389 of sequence End = position 395 of sequence helix = H RSFYTAIAQAFLSNEKL | | 389 395 Length = 1 Start = position 396 of sequence End = position 396 of sequence coil = C AQAFLSNEKLP | 396 Length = 3 Start = position 397 of sequence End = position 399 of sequence turns = T QAFLSNEKLPNLD | | 397 399 Length = 1 Start = position 400 of sequence End = position 400 of sequence coil = C LSNEKLPNLDC | 400 Length = 2 Start = position 401 of sequence End = position 402 of sequence turns = T SNEKLPNLDCIQ || 401402 Length = 1 Start = position 403 of sequence End = position 403 of sequence helix = H EKLPNLDCIQN | 403 Length = 1 Start = position 404 of sequence End = position 404 of sequence sheet = E KLPNLDCIQNA | 404 Length = 1 Start = position 405 of sequence End = position 405 of sequence helix = H LPNLDCIQNAN | 405 Length = 2 Start = position 406 of sequence End = position 407 of sequence sheet = E PNLDCIQNANKG || 406407 Length = 5 Start = position 408 of sequence End = position 412 of sequence turns = T LDCIQNANKGTHTSL | | 408 412 Length = 2 Start = position 413 of sequence End = position 414 of sequence coil = C NANKGTHTSLMQ || 413414 Length = 6 Start = position 415 of sequence End = position 420 of sequence sheet = E NKGTHTSLMQRLRNRG | | 415 420 Length = 8 Start = position 421 of sequence End = position 428 of sequence coil = C SLMQRLRNRGERDRERER | | 421 428 Length = 10 Start = position 429 of sequence End = position 438 of sequence helix = H RGERDREREREREMRRSSGL | | 429 438 Length = 2 Start = position 439 of sequence End = position 440 of sequence turns = T EREMRRSSGLRA || 439440 Length = 5 Start = position 441 of sequence End = position 445 of sequence coil = C EMRRSSGLRAGSRRD | | 441 445 Length = 1 Start = position 446 of sequence End = position 446 of sequence turns = T SGLRAGSRRDR | 446 Length = 1 Start = position 447 of sequence End = position 447 of sequence coil = C GLRAGSRRDRD | 447 Length = 15 Start = position 448 of sequence End = position 462 of sequence turns = T LRAGSRRDRDRDFRRQLSIDTRPFR | | 448 462 Length = 3 Start = position 463 of sequence End = position 465 of sequence coil = C QLSIDTRPFRPAS | | 463 465 Length = 1 Start = position 466 of sequence End = position 466 of sequence turns = T IDTRPFRPASE | 466 Length = 2 Start = position 467 of sequence End = position 468 of sequence coil = C DTRPFRPASEGN || 467468 Length = 1 Start = position 469 of sequence End = position 469 of sequence turns = T RPFRPASEGNP | 469 Length = 1 Start = position 470 of sequence End = position 470 of sequence coil = C PFRPASEGNPS | 470 Length = 2 Start = position 471 of sequence End = position 472 of sequence turns = T FRPASEGNPSDD || 471472 Length = 1 Start = position 473 of sequence End = position 473 of sequence coil = C PASEGNPSDDP | 473 Length = 3 Start = position 474 of sequence End = position 476 of sequence turns = T ASEGNPSDDPDPL | | 474 476 Length = 5 Start = position 477 of sequence End = position 481 of sequence coil = C GNPSDDPDPLPAHRQ | | 477 481 Length = 6 Start = position 482 of sequence End = position 487 of sequence helix = H DPDPLPAHRQALGERL | | 482 487 Length = 1 Start = position 488 of sequence End = position 488 of sequence coil = C AHRQALGERLY | 488 Length = 3 Start = position 489 of sequence End = position 491 of sequence turns = T HRQALGERLYPRV | | 489 491 Length = 2 Start = position 492 of sequence End = position 493 of sequence coil = C ALGERLYPRVQA || 492493 Length = 2 Start = position 494 of sequence End = position 495 of sequence turns = T GERLYPRVQAMQ || 494495 Length = 5 Start = position 496 of sequence End = position 500 of sequence sheet = E RLYPRVQAMQPAFAS | | 496 500 Length = 8 Start = position 501 of sequence End = position 508 of sequence helix = H VQAMQPAFASKITGMLLE | | 501 508 Length = 4 Start = position 509 of sequence End = position 512 of sequence sheet = E ASKITGMLLELSPA | | 509 512 Length = 31 Start = position 513 of sequence End = position 543 of sequence helix = H TGMLLELSPAQLLLLLASEDSLRARVEEAMELIVAHGRENG | | 513 543 Length = 3 Start = position 544 of sequence End = position 546 of sequence coil = C LIVAHGRENGADS | | 544 546 Length = 3 Start = position 547 of sequence End = position 549 of sequence turns = T AHGRENGADSILD | | 547 549 Length = 1 Start = position 550 of sequence End = position 550 of sequence coil = C RENGADSILDL | 550 Length = 5 Start = position 551 of sequence End = position 555 of sequence sheet = E ENGADSILDLGLLDS | | 551 555 Length = 2 Start = position 556 of sequence End = position 557 of sequence helix = H SILDLGLLDSSE || 556557 Length = 2 Start = position 558 of sequence End = position 559 of sequence coil = C LDLGLLDSSEKV || 558559 Length = 9 Start = position 560 of sequence End = position 568 of sequence helix = H LGLLDSSEKVQENRKRHGS | | 560 568 Length = 4 Start = position 569 of sequence End = position 572 of sequence turns = T VQENRKRHGSSRSV | | 569 572 Length = 2 Start = position 573 of sequence End = position 574 of sequence coil = C RKRHGSSRSVVD || 573574 Length = 1 Start = position 575 of sequence End = position 575 of sequence turns = T RHGSSRSVVDM | 575 Length = 7 Start = position 576 of sequence End = position 582 of sequence sheet = E HGSSRSVVDMDLDDTDD | | 576 582 Length = 8 Start = position 583 of sequence End = position 590 of sequence turns = T VDMDLDDTDDGDDNAPLF | | 583 590 Length = 2 Start = position 591 of sequence End = position 592 of sequence coil = C DDGDDNAPLFYQ || 591592 Length = 5 Start = position 593 of sequence End = position 597 of sequence sheet = E GDDNAPLFYQPGKRG | | 593 597 Length = 5 Start = position 598 of sequence End = position 602 of sequence turns = T PLFYQPGKRGFYTPR | | 598 602 Length = 3 Start = position 603 of sequence End = position 605 of sequence sheet = E PGKRGFYTPRPGK | | 603 605 Length = 2 Start = position 606 of sequence End = position 607 of sequence coil = C RGFYTPRPGKNT || 606607 Length = 2 Start = position 608 of sequence End = position 609 of sequence turns = T FYTPRPGKNTEA || 608609 Length = 3 Start = position 610 of sequence End = position 612 of sequence coil = C TPRPGKNTEARLN | | 610 612 Length = 1 Start = position 613 of sequence End = position 613 of sequence sheet = E PGKNTEARLNC | 613 Length = 3 Start = position 614 of sequence End = position 616 of sequence helix = H GKNTEARLNCFRN | | 614 616 Length = 8 Start = position 617 of sequence End = position 624 of sequence turns = T TEARLNCFRNIGRILGLC | | 617 624 Length = 6 Start = position 625 of sequence End = position 630 of sequence sheet = E RNIGRILGLCLLQNEL | | 625 630 Length = 4 Start = position 631 of sequence End = position 634 of sequence turns = T LGLCLLQNELCPIT | | 631 634 Length = 2 Start = position 635 of sequence End = position 636 of sequence sheet = E LLQNELCPITLN || 635636 Length = 2 Start = position 637 of sequence End = position 638 of sequence turns = T QNELCPITLNRH || 637638 Length = 4 Start = position 639 of sequence End = position 642 of sequence helix = H ELCPITLNRHVIKV | | 639 642 Length = 7 Start = position 643 of sequence End = position 649 of sequence sheet = E ITLNRHVIKVLLGRKVN | | 643 649 Length = 2 Start = position 650 of sequence End = position 651 of sequence turns = T IKVLLGRKVNWH || 650651 Length = 2 Start = position 652 of sequence End = position 653 of sequence coil = C VLLGRKVNWHDF || 652653 Length = 2 Start = position 654 of sequence End = position 655 of sequence turns = T LGRKVNWHDFAF || 654655 Length = 1 Start = position 656 of sequence End = position 656 of sequence coil = C RKVNWHDFAFF | 656 Length = 4 Start = position 657 of sequence End = position 660 of sequence turns = T KVNWHDFAFFDPVM | | 657 660 Length = 4 Start = position 661 of sequence End = position 664 of sequence coil = C HDFAFFDPVMYESL | | 661 664 Length = 8 Start = position 665 of sequence End = position 672 of sequence helix = H FFDPVMYESLRQLILASQ | | 665 672 Length = 3 Start = position 673 of sequence End = position 675 of sequence sheet = E SLRQLILASQSSD | | 673 675 Length = 5 Start = position 676 of sequence End = position 680 of sequence coil = C QLILASQSSDADAVF | | 676 680 Length = 19 Start = position 681 of sequence End = position 699 of sequence helix = H SQSSDADAVFSAMDLAFAVDLCKEEGGGQ | | 681 699 Length = 3 Start = position 700 of sequence End = position 702 of sequence turns = T DLCKEEGGGQVEL | | 700 702 Length = 2 Start = position 703 of sequence End = position 704 of sequence coil = C KEEGGGQVELIP || 703704 Length = 4 Start = position 705 of sequence End = position 708 of sequence sheet = E EGGGQVELIPNGVN | | 705 708 Length = 4 Start = position 709 of sequence End = position 712 of sequence turns = T QVELIPNGVNIPVT | | 709 712 Length = 1 Start = position 713 of sequence End = position 713 of sequence coil = C IPNGVNIPVTP | 713 Length = 5 Start = position 714 of sequence End = position 718 of sequence sheet = E PNGVNIPVTPQNVYE | | 714 718 Length = 1 Start = position 719 of sequence End = position 719 of sequence turns = T IPVTPQNVYEY | 719 Length = 5 Start = position 720 of sequence End = position 724 of sequence sheet = E PVTPQNVYEYVRKYA | | 720 724 Length = 24 Start = position 725 of sequence End = position 748 of sequence helix = H NVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLP | | 725 748 Length = 3 Start = position 749 of sequence End = position 751 of sequence sheet = E MRKGLLDVLPKNS | | 749 751 Length = 5 Start = position 752 of sequence End = position 756 of sequence coil = C GLLDVLPKNSLEDLT | | 752 756 Length = 11 Start = position 757 of sequence End = position 767 of sequence helix = H LPKNSLEDLTAEDFRLLVNGC | | 757 767 Length = 1 Start = position 768 of sequence End = position 768 of sequence sheet = E EDFRLLVNGCG | 768 Length = 1 Start = position 769 of sequence End = position 769 of sequence turns = T DFRLLVNGCGE | 769 Length = 1 Start = position 770 of sequence End = position 770 of sequence coil = C FRLLVNGCGEV | 770 Length = 2 Start = position 771 of sequence End = position 772 of sequence turns = T RLLVNGCGEVNV || 771772 Length = 2 Start = position 773 of sequence End = position 774 of sequence coil = C LVNGCGEVNVQM || 773774 Length = 9 Start = position 775 of sequence End = position 783 of sequence sheet = E NGCGEVNVQMLISFTSFND | | 775 783 Length = 8 Start = position 784 of sequence End = position 791 of sequence coil = C MLISFTSFNDESGENAEK | | 784 791 Length = 10 Start = position 792 of sequence End = position 801 of sequence helix = H NDESGENAEKLLQFKRWFWS | | 792 801 Length = 3 Start = position 802 of sequence End = position 804 of sequence turns = T LLQFKRWFWSIVE | | 802 804 Length = 8 Start = position 805 of sequence End = position 812 of sequence coil = C FKRWFWSIVERMSMTERQ | | 805 812 Length = 5 Start = position 813 of sequence End = position 817 of sequence helix = H VERMSMTERQDLVYF | | 813 817 Length = 1 Start = position 818 of sequence End = position 818 of sequence turns = T MTERQDLVYFW | 818 Length = 4 Start = position 819 of sequence End = position 822 of sequence sheet = E TERQDLVYFWTSSP | | 819 822 Length = 2 Start = position 823 of sequence End = position 824 of sequence turns = T DLVYFWTSSPSL || 823824 Length = 8 Start = position 825 of sequence End = position 832 of sequence coil = C VYFWTSSPSLPASEEGFQ | | 825 832 Length = 1 Start = position 833 of sequence End = position 833 of sequence helix = H SLPASEEGFQP | 833 Length = 3 Start = position 834 of sequence End = position 836 of sequence turns = T LPASEEGFQPMPS | | 834 836 Length = 3 Start = position 837 of sequence End = position 839 of sequence coil = C SEEGFQPMPSITI | | 837 839 Length = 2 Start = position 840 of sequence End = position 841 of sequence turns = T GFQPMPSITIRP || 840841 Length = 4 Start = position 842 of sequence End = position 845 of sequence sheet = E QPMPSITIRPPDDQ | | 842 845 Length = 1 Start = position 846 of sequence End = position 846 of sequence coil = C SITIRPPDDQH | 846 Length = 4 Start = position 847 of sequence End = position 850 of sequence turns = T ITIRPPDDQHLPTA | | 847 850 Length = 2 Start = position 851 of sequence End = position 852 of sequence coil = C PPDDQHLPTANT || 851852 Length = 5 Start = position 853 of sequence End = position 857 of sequence turns = T DDQHLPTANTCISRL | | 853 857 Length = 8 Start = position 858 of sequence End = position 865 of sequence sheet = E PTANTCISRLYVPLYSSK | | 858 865 Length = 3 Start = position 866 of sequence End = position 868 of sequence turns = T RLYVPLYSSKQIL | | 866 868 Length = 14 Start = position 869 of sequence End = position 882 of sequence helix = H VPLYSSKQILKQKLLLAIKTKNFG | | 869 882 Length = 5 Start = position 883 of sequence End = position 887 of sequence turns = T LLAIKTKNFGFV | | 883 887 Length = 2 Start = position 888 of sequence End = position 889 of sequence sheet = E TKNFGFV || 888889 #--------------------------------------- # # Residue totals: H:364 E:149 T:191 C:185 # percent: H: 41.7 E: 17.1 T: 21.9 C: 21.2 # #---------------------------------------