|
|
eiprscan |
Please help by correcting and extending the Wiki pages.
% eiprscan -nocrc -goterms -iprlookup
Motif detection
Input sequence set: iprtest.seq
Applications to use
all : all
blastprodom : blastprodom
coils : coils
gene3d : gene3d
hmmpanther : hmmpanther
hmmpir : hmmpir
hmmpfam : hmmpfam
hmmsmart : hmmsmart
hmmtigr : hmmtigr
fprintscan : fprintscan
scanregexp : scanregexp
profilescan : profilescan
superfamily : superfamily
seg : seg
signalp : signalp
tmhmm : tmhmm
Application(s) to use [all]:
Output Formats
raw : Raw
txt : Text
html : Html
xml : Xml
ebixml : EBIxml
gff : GFF
Format to use [xml]: raw
EIPRSCAN program output file [iprtest.eiprscan]:
SUBMITTED-iprscan-20080715-12345678
|
Go to the input files for this example
Go to the output files for this example
Standard (Mandatory) qualifiers:
[-sequence] seqset Sequence set filename and optional format,
or reference (input USA)
-appl menu [all] Application(s) to use (Values: all
(all); blastprodom (blastprodom); coils
(coils); gene3d (gene3d); hmmpanther
(hmmpanther); hmmpir (hmmpir); hmmpfam
(hmmpfam); hmmsmart (hmmsmart); hmmtigr
(hmmtigr); fprintscan (fprintscan);
scanregexp (scanregexp); profilescan
(profilescan); superfamily (superfamily);
seg (seg); signalp (signalp); tmhmm (tmhmm))
-format menu [xml] Format to use (Values: raw (Raw); txt
(Text); html (Html); xml (Xml); ebixml
(EBIxml); gff (GFF))
[-outfile] outfile [*.eiprscan] EIPRSCAN program output file
Additional (Optional) qualifiers (* if not always prompted):
-email string Submitter email address (Any string)
-trtable menu [0] Genetic codes used for translation
(Values: 0 (Standard); 1 (Standard (with
alternative initiation codons)); 2
(Vertebrate Mitochondrial); 3 (Yeast
Mitochondrial); 4 (Mold, Protozoan,
Coelenterate Mitochondrial and
Mycoplasma/Spiroplasma); 5 (Invertebrate
Mitochondrial); 6 (Ciliate Macronuclear and
Dasycladacean); 9 (Echinoderm
Mitochondrial); 10 (Euplotid Nuclear); 11
(Bacterial); 12 (Alternative Yeast Nuclear);
13 (Ascidian Mitochondrial); 14 (Flatworm
Mitochondrial); 15 (Blepharisma
Macronuclear); 16 (Chlorophycean
Mitochondrial); 21 (Trematode
Mitochondrial); 22 (Scenedesmus obliquus);
23 (Thraustochytrium Mitochondrial))
-trlen integer [1] Minimum size of Open Reading Frames
(ORFs) in the translations. (Integer 1 or
more)
-iprlookup boolean [N] Turn on InterPro lookup for results
* -goterms boolean [N] Show GO terms in InterPro lookup
-[no]crc boolean [Y] Perform CRC64 check
-altjobs boolean [N] Launch jobs alternately (chunk after
chunk)
Advanced (Unprompted) qualifiers: (none)
Associated qualifiers:
"-sequence" associated qualifiers
-sbegin1 integer Start of each sequence to be used
-send1 integer End of each sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-sformat1 string Input sequence format
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-outfile" associated qualifiers
-odirectory2 string Output directory
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write first file to standard output
-filter boolean Read first file from standard input, write
first file to standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
|
| Qualifier | Type | Description | Allowed values | Default | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Standard (Mandatory) qualifiers | ||||||||||||||||||||||||||||||||||||||||
| [-sequence] (Parameter 1) |
seqset | Sequence set filename and optional format, or reference (input USA) | Readable set of sequences | Required | ||||||||||||||||||||||||||||||||||||
| -appl | list | Application(s) to use |
|
all | ||||||||||||||||||||||||||||||||||||
| -format | list | Format to use |
|
xml | ||||||||||||||||||||||||||||||||||||
| [-outfile] (Parameter 2) |
outfile | EIPRSCAN program output file | Output file | <*>.eiprscan | ||||||||||||||||||||||||||||||||||||
| Additional (Optional) qualifiers | ||||||||||||||||||||||||||||||||||||||||
| string | Submitter email address | Any string | ||||||||||||||||||||||||||||||||||||||
| -trtable | list | Genetic codes used for translation |
|
0 | ||||||||||||||||||||||||||||||||||||
| -trlen | integer | Minimum size of Open Reading Frames (ORFs) in the translations. | Integer 1 or more | 1 | ||||||||||||||||||||||||||||||||||||
| -iprlookup | boolean | Turn on InterPro lookup for results | Boolean value Yes/No | No | ||||||||||||||||||||||||||||||||||||
| -goterms | boolean | Show GO terms in InterPro lookup | Boolean value Yes/No | No | ||||||||||||||||||||||||||||||||||||
| -[no]crc | boolean | Perform CRC64 check | Boolean value Yes/No | Yes | ||||||||||||||||||||||||||||||||||||
| -altjobs | boolean | Launch jobs alternately (chunk after chunk) | Boolean value Yes/No | No | ||||||||||||||||||||||||||||||||||||
| Advanced (Unprompted) qualifiers | ||||||||||||||||||||||||||||||||||||||||
| (none) | ||||||||||||||||||||||||||||||||||||||||
>RS16_ECOLI MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHW VGQGATISDRVAALIKEVNKAA >Q9RHD9 XPKLEEGVEGLVHVSEMDWTNKNIHPSKVVQVGDEVEVQVLDIDEERRRISLGIKQCKSN PWEDFSSQFNKGDRISGSIKSITDFGIFIGLDGGIDGLVHLSDISWNEVGEEAVRRFKKG DELETVILSVDPERERISLGIKQLEDDPFSNYASLHEKGSIVRGTVKEVDAKGAVISLGD DIEGILKASEISRDRVEDARNVLKEGEEVEAKIISIDRKSRVISLSVKSKDVDDEKDAMK ELRKQEVESAGPTTIGDLIRAQMENQG >Y902_MYCTU Q10560 PROBABLE SENSOR-LIKE HISTIDINE KINASE RV0902C (EC 2.7.3.-). MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRRLDEAAGFA IPFVPRGLDEIPRSPNDQDALITVRRGNVIKSNSDITLPKLQDDYADTYVRGVRYRVRTV EIPGPEPTSVAVGATYDATVAETNNLHRRVLLICTFAIGAAAVFAWLLAAFAVRPFKQLA EQTRSIDAGDEAPRVEVHGASEAIEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSH ELRTPLTAMRTNLEVLSTLDLPDDQRKEVLNDVIRTQSRIEATLSALERLAQGELSTSDD HVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGA TLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSRGSTASHSGSGLGLALVAQQAQ LHGGTASLENSPLGGARLVLRLPGPS |
RS16_ECOLI F94D07049A6D489D 82 BlastProDom PD003791 RS16_BUCAI_P57474; 9 77 1e-19 T 14-Jul-2009 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 Coil coil coiled-coil 225 246 NA ? 14-Jul-2009 NULL NULL RS16_ECOLI F94D07049A6D489D 82 Gene3D G3DSA:3.30.1320.10 no description 1 77 1.7e-25 T 14-Jul-2009 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 Gene3D G3DSA:2.40.50.140 no description 3 57 4.5e-10 T 14-Jul-2009 IPR012340 Nucleic acid-binding, OB-fold Q9RHD9 D44DAE8C544CB7C1 267 Gene3D G3DSA:2.40.50.140 no description 67 144 1.3e-16 T 14-Jul-2009 IPR012340 Nucleic acid-binding, OB-fold Q9RHD9 D44DAE8C544CB7C1 267 Gene3D G3DSA:2.40.50.140 no description 156 230 9.2e-17 T 14-Jul-2009 IPR012340 Nucleic acid-binding, OB-fold Y902_MYCTU CD84A335CCFFE6D7 446 Gene3D G3DSA:3.30.565.10 no description 301 443 6.3e-25 T 14-Jul-2009 IPR003594 ATP-binding region, ATPase-like Molecular Function: ATP binding (GO:0005524) Y902_MYCTU CD84A335CCFFE6D7 446 HMMPanther PTHR23283:SF23 SENSORY TRANSDUCTION HISTIDINE KINASE (BACTERIAL SENSOR PROTEIN) 6 57 1.9e-48 T 14-Jul-2009 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 HMMPanther PTHR23283:SF23 SENSORY TRANSDUCTION HISTIDINE KINASE (BACTERIAL SENSOR PROTEIN) 151 443 1.9e-48 T 14-Jul-2009 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 HMMPanther PTHR23283 SENSOR HISTIDINE KINASE-RELATED 6 57 1.9e-48 T 14-Jul-2009 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 HMMPanther PTHR23283 SENSOR HISTIDINE KINASE-RELATED 151 443 1.9e-48 T 14-Jul-2009 NULL NULL RS16_ECOLI F94D07049A6D489D 82 HMMPanther PTHR12919 30S RIBOSOMAL PROTEIN S16 1 78 4.2e-36 T 14-Jul-2009 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 HMMPanther PTHR23270 PROGRAMMED CELL DEATH PROTEIN 11 (PRE-RRNA PROCESSING PROTEIN RRP5) 72 239 2.6e-09 T 14-Jul-2009 NULL NULL RS16_ECOLI F94D07049A6D489D 82 HMMPfam PF00886 Ribosomal_S16 8 68 1.5e-35 T 14-Jul-2009 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 HMMPfam PF00575 S1 1 55 1.9e-08 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 HMMPfam PF00575 S1 68 142 2.2e-21 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 HMMPfam PF00575 S1 155 228 9.7e-22 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Y902_MYCTU CD84A335CCFFE6D7 446 HMMPfam PF00672 HAMP 151 219 4.7e-11 T 14-Jul-2009 IPR003660 Signal transduction histidine kinase, HAMP region Molecular Function: signal transducer activity (GO:0004871), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 HMMPfam PF00512 HisKA 230 296 1.3e-13 T 14-Jul-2009 IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region Molecular Function: two-component sensor activity (GO:0000155), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 HMMPfam PF02518 HATPase_c 338 445 3.4e-29 T 14-Jul-2009 IPR003594 ATP-binding region, ATPase-like Molecular Function: ATP binding (GO:0005524) Q9RHD9 D44DAE8C544CB7C1 267 HMMSmart SM00316 no description 3 55 1.2e-06 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 HMMSmart SM00316 no description 70 142 1.4e-19 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 HMMSmart SM00316 no description 157 228 2.6e-21 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Y902_MYCTU CD84A335CCFFE6D7 446 HMMSmart SM00304 no description 170 222 3.1e-06 T 14-Jul-2009 IPR003660 Signal transduction histidine kinase, HAMP region Molecular Function: signal transducer activity (GO:0004871), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 HMMSmart SM00388 no description 230 296 2.4e-12 T 14-Jul-2009 IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region Molecular Function: two-component sensor activity (GO:0000155), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 HMMSmart SM00387 no description 338 446 5e-24 T 14-Jul-2009 IPR003594 ATP-binding region, ATPase-like Molecular Function: ATP binding (GO:0005524) RS16_ECOLI F94D07049A6D489D 82 HMMTigr TIGR00002 S16: ribosomal protein S16 2 81 1.8e-32 T 14-Jul-2009 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 FPrintScan PR00681 RIBOSOMALS1 6 27 7.9e-17 T 14-Jul-2009 IPR000110 Ribosomal protein S1 Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 FPrintScan PR00681 RIBOSOMALS1 85 104 7.9e-17 T 14-Jul-2009 IPR000110 Ribosomal protein S1 Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 FPrintScan PR00681 RIBOSOMALS1 125 143 7.9e-17 T 14-Jul-2009 IPR000110 Ribosomal protein S1 Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Y902_MYCTU CD84A335CCFFE6D7 446 FPrintScan PR00344 BCTRLSENSOR 374 388 1.1e-11 T 14-Jul-2009 IPR004358 Signal transduction histidine kinase-related protein, C-terminal Biological Process: phosphorylation (GO:0016310), Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772) Y902_MYCTU CD84A335CCFFE6D7 446 FPrintScan PR00344 BCTRLSENSOR 392 402 1.1e-11 T 14-Jul-2009 IPR004358 Signal transduction histidine kinase-related protein, C-terminal Biological Process: phosphorylation (GO:0016310), Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772) Y902_MYCTU CD84A335CCFFE6D7 446 FPrintScan PR00344 BCTRLSENSOR 406 424 1.1e-11 T 14-Jul-2009 IPR004358 Signal transduction histidine kinase-related protein, C-terminal Biological Process: phosphorylation (GO:0016310), Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772) Y902_MYCTU CD84A335CCFFE6D7 446 FPrintScan PR00344 BCTRLSENSOR 430 443 1.1e-11 T 14-Jul-2009 IPR004358 Signal transduction histidine kinase-related protein, C-terminal Biological Process: phosphorylation (GO:0016310), Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772) RS16_ECOLI F94D07049A6D489D 82 ScanRegExp PS00732 RIBOSOMAL_S16 2 11 8e-5 T 14-Jul-2009 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 ProfileScan PS50126 S1 1 55 14.869 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 ProfileScan PS50126 S1 72 142 20.809 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 ProfileScan PS50126 S1 159 228 22.541 T 14-Jul-2009 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Y902_MYCTU CD84A335CCFFE6D7 446 ProfileScan PS50885 HAMP 170 222 7.777 T 14-Jul-2009 IPR003660 Signal transduction histidine kinase, HAMP region Molecular Function: signal transducer activity (GO:0004871), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 ProfileScan PS50109 HIS_KIN 237 446 34.449 T 14-Jul-2009 IPR005467 Signal transduction histidine kinase, core Molecular Function: two-component sensor activity (GO:0000155), Molecular Function: protein histidine kinase activity (GO:0004673), Biological Process: signal transduction (GO:0007165), Biological Process: peptidyl-histidine phosphorylation (GO:0018106) RS16_ECOLI F94D07049A6D489D 82 superfamily SSF54565 Ribosomal protein S16 1 79 3.1e-27 T 14-Jul-2009 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 superfamily SSF50249 Nucleic acid-binding proteins 67 220 7.6e-41 T 14-Jul-2009 IPR016027 Nucleic acid-binding, OB-fold-like Q9RHD9 D44DAE8C544CB7C1 267 superfamily SSF50249 Nucleic acid-binding proteins 3 61 1.4e-14 T 14-Jul-2009 IPR016027 Nucleic acid-binding, OB-fold-like Y902_MYCTU CD84A335CCFFE6D7 446 superfamily SSF55874 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 303 444 8e-31 T 14-Jul-2009 IPR003594 ATP-binding region, ATPase-like Molecular Function: ATP binding (GO:0005524) Y902_MYCTU CD84A335CCFFE6D7 446 superfamily SSF47384 Homodimeric domain of signal transducing histidine kinase 220 292 4.8e-12 T 14-Jul-2009 IPR009082 Signal transduction histidine kinase, homodimeric Molecular Function: signal transducer activity (GO:0004871), Biological Process: signal transduction (GO:0007165) Q9RHD9 D44DAE8C544CB7C1 267 Seg seg seg 29 40 NA ? 14-Jul-2009 NULL NULL Q9RHD9 D44DAE8C544CB7C1 267 Seg seg seg 84 98 NA ? 14-Jul-2009 NULL NULL Q9RHD9 D44DAE8C544CB7C1 267 Seg seg seg 222 237 NA ? 14-Jul-2009 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 44 55 NA ? 14-Jul-2009 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 108 120 NA ? 14-Jul-2009 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 160 173 NA ? 14-Jul-2009 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 308 319 NA ? 14-Jul-2009 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 400 424 NA ? 14-Jul-2009 NULL NULL |
| Program name | Description |
|---|---|
| antigenic | Finds antigenic sites in proteins |
| digest | Reports on protein proteolytic enzyme or reagent cleavage sites |
| echlorop | Reports presence of chloroplast transit peptides |
| elipop | Prediction of lipoproteins |
| emast | Motif detection |
| ememe | Multiple EM for Motif Elicitation |
| ememetext | Multiple EM for Motif Elicitation. Text file only |
| enetnglyc | Reports N-glycosylation sites in human proteins |
| enetoglyc | Reports mucin type GalNAc O-glycosylation sites in mammalian proteins |
| enetphos | Reports ser, thr and tyr phosphorylation sites in eukaryotic proteins |
| epestfind | Finds PEST motifs as potential proteolytic cleavage sites |
| eprop | Reports propeptide cleavage sites in proteins |
| esignalp | Reports protein signal cleavage sites |
| etmhmm | Reports transmembrane helices |
| eyinoyang | Reports O-(beta)-GlcNAc attachment sites |
| fuzzpro | Search for patterns in protein sequences |
| fuzztran | Search for patterns in protein sequences (translated) |
| helixturnhelix | Identify nucleic acid-binding motifs in protein sequences |
| oddcomp | Identify proteins with specified sequence word composition |
| omeme | Motif detection |
| patmatdb | Searches protein sequences with a sequence motif |
| patmatmotifs | Scan a protein sequence with motifs from the PROSITE database |
| pepcoil | Predicts coiled coil regions in protein sequences |
| preg | Regular expression search of protein sequence(s) |
| pscan | Scans protein sequence(s) with fingerprints from the PRINTS database |
| sigcleave | Reports on signal cleavage sites in a protein sequence |
The original iprscan application must be installed and configured to use this wrapper.
Although we take every care to ensure that the results of the EMBOSS version are identical to those from the original package, we recommend that you check your inputs give the same results in both versions before publication.
Please report all bugs in the EMBOSS version to the EMBOSS bug team, not to the original author.