|
|
eiprscan |
Please help by correcting and extending the Wiki pages.
% eiprscan -nocrc -goterms -iprlookup
Motif detection
Input sequence set: iprtest.seq
Applications to use
all : all
blastprodom : blastprodom
coils : coils
gene3d : gene3d
hmmpanther : hmmpanther
hmmpir : hmmpir
hmmpfam : hmmpfam
hmmsmart : hmmsmart
hmmtigr : hmmtigr
fprintscan : fprintscan
scanregexp : scanregexp
profilescan : profilescan
superfamily : superfamily
seg : seg
signalp : signalp
tmhmm : tmhmm
Application(s) to use [all]:
Output Formats
raw : Raw
txt : Text
html : Html
xml : Xml
ebixml : EBIxml
gff : GFF
Format to use [xml]: raw
EIPRSCAN program output file [iprtest.eiprscan]:
SUBMITTED-iprscan-20100715-12345678
|
Go to the input files for this example
Go to the output files for this example
Motif detection
Version: EMBOSS:6.3.0
Standard (Mandatory) qualifiers:
[-sequence] seqset Sequence set filename and optional format,
or reference (input USA)
-appl menu [all] Application(s) to use (Values: all
(all); blastprodom (blastprodom); coils
(coils); gene3d (gene3d); hmmpanther
(hmmpanther); hmmpir (hmmpir); hmmpfam
(hmmpfam); hmmsmart (hmmsmart); hmmtigr
(hmmtigr); fprintscan (fprintscan);
scanregexp (scanregexp); profilescan
(profilescan); superfamily (superfamily);
seg (seg); signalp (signalp); tmhmm (tmhmm))
-format menu [xml] Format to use (Values: raw (Raw); txt
(Text); html (Html); xml (Xml); ebixml
(EBIxml); gff (GFF))
[-outfile] outfile [*.eiprscan] EIPRSCAN program output file
Additional (Optional) qualifiers (* if not always prompted):
-email string Submitter email address (Any string)
-trtable menu [0] Genetic codes used for translation
(Values: 0 (Standard); 1 (Standard (with
alternative initiation codons)); 2
(Vertebrate Mitochondrial); 3 (Yeast
Mitochondrial); 4 (Mold, Protozoan,
Coelenterate Mitochondrial and
Mycoplasma/Spiroplasma); 5 (Invertebrate
Mitochondrial); 6 (Ciliate Macronuclear and
Dasycladacean); 9 (Echinoderm
Mitochondrial); 10 (Euplotid Nuclear); 11
(Bacterial); 12 (Alternative Yeast Nuclear);
13 (Ascidian Mitochondrial); 14 (Flatworm
Mitochondrial); 15 (Blepharisma
Macronuclear); 16 (Chlorophycean
Mitochondrial); 21 (Trematode
Mitochondrial); 22 (Scenedesmus obliquus);
23 (Thraustochytrium Mitochondrial))
-trlen integer [1] Minimum size of Open Reading Frames
(ORFs) in the translations. (Integer 1 or
more)
-iprlookup boolean [N] Turn on InterPro lookup for results
* -goterms boolean [N] Show GO terms in InterPro lookup
-[no]crc boolean [Y] Perform CRC64 check
-altjobs boolean [N] Launch jobs alternately (chunk after
chunk)
Advanced (Unprompted) qualifiers: (none)
Associated qualifiers:
"-sequence" associated qualifiers
-sbegin1 integer Start of each sequence to be used
-send1 integer End of each sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-sformat1 string Input sequence format
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-outfile" associated qualifiers
-odirectory2 string Output directory
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write first file to standard output
-filter boolean Read first file from standard input, write
first file to standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options and exit. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
-version boolean Report version number and exit
|
| Qualifier | Type | Description | Allowed values | Default | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Standard (Mandatory) qualifiers | ||||||||||||||||||||||||||||||||||||||||
| [-sequence] (Parameter 1) |
seqset | Sequence set filename and optional format, or reference (input USA) | Readable set of sequences | Required | ||||||||||||||||||||||||||||||||||||
| -appl | list | Application(s) to use |
|
all | ||||||||||||||||||||||||||||||||||||
| -format | list | Format to use |
|
xml | ||||||||||||||||||||||||||||||||||||
| [-outfile] (Parameter 2) |
outfile | EIPRSCAN program output file | Output file | <*>.eiprscan | ||||||||||||||||||||||||||||||||||||
| Additional (Optional) qualifiers | ||||||||||||||||||||||||||||||||||||||||
| string | Submitter email address | Any string | ||||||||||||||||||||||||||||||||||||||
| -trtable | list | Genetic codes used for translation |
|
0 | ||||||||||||||||||||||||||||||||||||
| -trlen | integer | Minimum size of Open Reading Frames (ORFs) in the translations. | Integer 1 or more | 1 | ||||||||||||||||||||||||||||||||||||
| -iprlookup | boolean | Turn on InterPro lookup for results | Boolean value Yes/No | No | ||||||||||||||||||||||||||||||||||||
| -goterms | boolean | Show GO terms in InterPro lookup | Boolean value Yes/No | No | ||||||||||||||||||||||||||||||||||||
| -[no]crc | boolean | Perform CRC64 check | Boolean value Yes/No | Yes | ||||||||||||||||||||||||||||||||||||
| -altjobs | boolean | Launch jobs alternately (chunk after chunk) | Boolean value Yes/No | No | ||||||||||||||||||||||||||||||||||||
| Advanced (Unprompted) qualifiers | ||||||||||||||||||||||||||||||||||||||||
| (none) | ||||||||||||||||||||||||||||||||||||||||
| Associated qualifiers | ||||||||||||||||||||||||||||||||||||||||
| "-sequence" associated seqset qualifiers | ||||||||||||||||||||||||||||||||||||||||
| -sbegin1 -sbegin_sequence |
integer | Start of each sequence to be used | Any integer value | 0 | ||||||||||||||||||||||||||||||||||||
| -send1 -send_sequence |
integer | End of each sequence to be used | Any integer value | 0 | ||||||||||||||||||||||||||||||||||||
| -sreverse1 -sreverse_sequence |
boolean | Reverse (if DNA) | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -sask1 -sask_sequence |
boolean | Ask for begin/end/reverse | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -snucleotide1 -snucleotide_sequence |
boolean | Sequence is nucleotide | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -sprotein1 -sprotein_sequence |
boolean | Sequence is protein | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -slower1 -slower_sequence |
boolean | Make lower case | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -supper1 -supper_sequence |
boolean | Make upper case | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -sformat1 -sformat_sequence |
string | Input sequence format | Any string | |||||||||||||||||||||||||||||||||||||
| -sdbname1 -sdbname_sequence |
string | Database name | Any string | |||||||||||||||||||||||||||||||||||||
| -sid1 -sid_sequence |
string | Entryname | Any string | |||||||||||||||||||||||||||||||||||||
| -ufo1 -ufo_sequence |
string | UFO features | Any string | |||||||||||||||||||||||||||||||||||||
| -fformat1 -fformat_sequence |
string | Features format | Any string | |||||||||||||||||||||||||||||||||||||
| -fopenfile1 -fopenfile_sequence |
string | Features file name | Any string | |||||||||||||||||||||||||||||||||||||
| "-outfile" associated outfile qualifiers | ||||||||||||||||||||||||||||||||||||||||
| -odirectory2 -odirectory_outfile |
string | Output directory | Any string | |||||||||||||||||||||||||||||||||||||
| General qualifiers | ||||||||||||||||||||||||||||||||||||||||
| -auto | boolean | Turn off prompts | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -stdout | boolean | Write first file to standard output | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -filter | boolean | Read first file from standard input, write first file to standard output | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -options | boolean | Prompt for standard and additional values | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -debug | boolean | Write debug output to program.dbg | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -verbose | boolean | Report some/full command line options | Boolean value Yes/No | Y | ||||||||||||||||||||||||||||||||||||
| -help | boolean | Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
| -warning | boolean | Report warnings | Boolean value Yes/No | Y | ||||||||||||||||||||||||||||||||||||
| -error | boolean | Report errors | Boolean value Yes/No | Y | ||||||||||||||||||||||||||||||||||||
| -fatal | boolean | Report fatal errors | Boolean value Yes/No | Y | ||||||||||||||||||||||||||||||||||||
| -die | boolean | Report dying program messages | Boolean value Yes/No | Y | ||||||||||||||||||||||||||||||||||||
| -version | boolean | Report version number and exit | Boolean value Yes/No | N | ||||||||||||||||||||||||||||||||||||
>RS16_ECOLI MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHW VGQGATISDRVAALIKEVNKAA >Q9RHD9 XPKLEEGVEGLVHVSEMDWTNKNIHPSKVVQVGDEVEVQVLDIDEERRRISLGIKQCKSN PWEDFSSQFNKGDRISGSIKSITDFGIFIGLDGGIDGLVHLSDISWNEVGEEAVRRFKKG DELETVILSVDPERERISLGIKQLEDDPFSNYASLHEKGSIVRGTVKEVDAKGAVISLGD DIEGILKASEISRDRVEDARNVLKEGEEVEAKIISIDRKSRVISLSVKSKDVDDEKDAMK ELRKQEVESAGPTTIGDLIRAQMENQG >Y902_MYCTU Q10560 PROBABLE SENSOR-LIKE HISTIDINE KINASE RV0902C (EC 2.7.3.-). MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRRLDEAAGFA IPFVPRGLDEIPRSPNDQDALITVRRGNVIKSNSDITLPKLQDDYADTYVRGVRYRVRTV EIPGPEPTSVAVGATYDATVAETNNLHRRVLLICTFAIGAAAVFAWLLAAFAVRPFKQLA EQTRSIDAGDEAPRVEVHGASEAIEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSH ELRTPLTAMRTNLEVLSTLDLPDDQRKEVLNDVIRTQSRIEATLSALERLAQGELSTSDD HVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGA TLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSRGSTASHSGSGLGLALVAQQAQ LHGGTASLENSPLGGARLVLRLPGPS |
RS16_ECOLI F94D07049A6D489D 82 BlastProDom PD003791 RS16_BUCAI_P57474; 9 77 1e-19 T 05-Jul-2010 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 Coil coil coiled-coil 225 246 NA ? 05-Jul-2010 NULL NULL RS16_ECOLI F94D07049A6D489D 82 Gene3D G3DSA:3.30.1320.10 no description 1 77 1.7e-25 T 05-Jul-2010 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 Gene3D G3DSA:2.40.50.140 no description 3 57 4.5e-10 T 05-Jul-2010 IPR012340 Nucleic acid-binding, OB-fold Q9RHD9 D44DAE8C544CB7C1 267 Gene3D G3DSA:2.40.50.140 no description 67 144 1.3e-16 T 05-Jul-2010 IPR012340 Nucleic acid-binding, OB-fold Q9RHD9 D44DAE8C544CB7C1 267 Gene3D G3DSA:2.40.50.140 no description 156 230 9.2e-17 T 05-Jul-2010 IPR012340 Nucleic acid-binding, OB-fold Y902_MYCTU CD84A335CCFFE6D7 446 Gene3D G3DSA:3.30.565.10 no description 301 443 6.3e-25 T 05-Jul-2010 IPR003594 ATP-binding region, ATPase-like Molecular Function: ATP binding (GO:0005524) Y902_MYCTU CD84A335CCFFE6D7 446 HMMPanther PTHR23283:SF23 SENSORY TRANSDUCTION HISTIDINE KINASE (BACTERIAL SENSOR PROTEIN) 6 57 1.9e-48 T 05-Jul-2010 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 HMMPanther PTHR23283:SF23 SENSORY TRANSDUCTION HISTIDINE KINASE (BACTERIAL SENSOR PROTEIN) 151 443 1.9e-48 T 05-Jul-2010 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 HMMPanther PTHR23283 SENSOR HISTIDINE KINASE-RELATED 6 57 1.9e-48 T 05-Jul-2010 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 HMMPanther PTHR23283 SENSOR HISTIDINE KINASE-RELATED 151 443 1.9e-48 T 05-Jul-2010 NULL NULL RS16_ECOLI F94D07049A6D489D 82 HMMPanther PTHR12919 30S RIBOSOMAL PROTEIN S16 1 78 4.2e-36 T 05-Jul-2010 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 HMMPanther PTHR23270 PROGRAMMED CELL DEATH PROTEIN 11 (PRE-RRNA PROCESSING PROTEIN RRP5) 72 239 2.6e-09 T 05-Jul-2010 NULL NULL RS16_ECOLI F94D07049A6D489D 82 HMMPfam PF00886 Ribosomal_S16 8 68 1.5e-35 T 05-Jul-2010 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 HMMPfam PF00575 S1 1 55 1.9e-08 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 HMMPfam PF00575 S1 68 142 2.2e-21 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 HMMPfam PF00575 S1 155 228 9.7e-22 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Y902_MYCTU CD84A335CCFFE6D7 446 HMMPfam PF00672 HAMP 151 219 4.7e-11 T 05-Jul-2010 IPR003660 Signal transduction histidine kinase, HAMP region Molecular Function: signal transducer activity (GO:0004871), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 HMMPfam PF00512 HisKA 230 296 1.3e-13 T 05-Jul-2010 IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region Molecular Function: two-component sensor activity (GO:0000155), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 HMMPfam PF02518 HATPase_c 338 445 3.4e-29 T 05-Jul-2010 IPR003594 ATP-binding region, ATPase-like Molecular Function: ATP binding (GO:0005524) Q9RHD9 D44DAE8C544CB7C1 267 HMMSmart SM00316 no description 3 55 1.2e-06 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 HMMSmart SM00316 no description 70 142 1.4e-19 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 HMMSmart SM00316 no description 157 228 2.6e-21 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Y902_MYCTU CD84A335CCFFE6D7 446 HMMSmart SM00304 no description 170 222 3.1e-06 T 05-Jul-2010 IPR003660 Signal transduction histidine kinase, HAMP region Molecular Function: signal transducer activity (GO:0004871), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 HMMSmart SM00388 no description 230 296 2.4e-12 T 05-Jul-2010 IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region Molecular Function: two-component sensor activity (GO:0000155), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 HMMSmart SM00387 no description 338 446 5e-24 T 05-Jul-2010 IPR003594 ATP-binding region, ATPase-like Molecular Function: ATP binding (GO:0005524) RS16_ECOLI F94D07049A6D489D 82 HMMTigr TIGR00002 S16: ribosomal protein S16 2 81 1.8e-32 T 05-Jul-2010 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 FPrintScan PR00681 RIBOSOMALS1 6 27 7.9e-17 T 05-Jul-2010 IPR000110 Ribosomal protein S1 Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 FPrintScan PR00681 RIBOSOMALS1 85 104 7.9e-17 T 05-Jul-2010 IPR000110 Ribosomal protein S1 Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 FPrintScan PR00681 RIBOSOMALS1 125 143 7.9e-17 T 05-Jul-2010 IPR000110 Ribosomal protein S1 Molecular Function: RNA binding (GO:0003723), Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Y902_MYCTU CD84A335CCFFE6D7 446 FPrintScan PR00344 BCTRLSENSOR 374 388 1.1e-11 T 05-Jul-2010 IPR004358 Signal transduction histidine kinase-related protein, C-terminal Biological Process: phosphorylation (GO:0016310), Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772) Y902_MYCTU CD84A335CCFFE6D7 446 FPrintScan PR00344 BCTRLSENSOR 392 402 1.1e-11 T 05-Jul-2010 IPR004358 Signal transduction histidine kinase-related protein, C-terminal Biological Process: phosphorylation (GO:0016310), Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772) Y902_MYCTU CD84A335CCFFE6D7 446 FPrintScan PR00344 BCTRLSENSOR 406 424 1.1e-11 T 05-Jul-2010 IPR004358 Signal transduction histidine kinase-related protein, C-terminal Biological Process: phosphorylation (GO:0016310), Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772) Y902_MYCTU CD84A335CCFFE6D7 446 FPrintScan PR00344 BCTRLSENSOR 430 443 1.1e-11 T 05-Jul-2010 IPR004358 Signal transduction histidine kinase-related protein, C-terminal Biological Process: phosphorylation (GO:0016310), Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772) RS16_ECOLI F94D07049A6D489D 82 ScanRegExp PS00732 RIBOSOMAL_S16 2 11 8e-5 T 05-Jul-2010 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 ProfileScan PS50126 S1 1 55 14.869 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 ProfileScan PS50126 S1 72 142 20.809 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Q9RHD9 D44DAE8C544CB7C1 267 ProfileScan PS50126 S1 159 228 22.541 T 05-Jul-2010 IPR003029 S1, RNA binding Molecular Function: RNA binding (GO:0003723) Y902_MYCTU CD84A335CCFFE6D7 446 ProfileScan PS50885 HAMP 170 222 7.777 T 05-Jul-2010 IPR003660 Signal transduction histidine kinase, HAMP region Molecular Function: signal transducer activity (GO:0004871), Biological Process: signal transduction (GO:0007165), Cellular Component: membrane (GO:0016020) Y902_MYCTU CD84A335CCFFE6D7 446 ProfileScan PS50109 HIS_KIN 237 446 34.449 T 05-Jul-2010 IPR005467 Signal transduction histidine kinase, core Molecular Function: two-component sensor activity (GO:0000155), Molecular Function: protein histidine kinase activity (GO:0004673), Biological Process: signal transduction (GO:0007165), Biological Process: peptidyl-histidine phosphorylation (GO:0018106) RS16_ECOLI F94D07049A6D489D 82 superfamily SSF54565 Ribosomal protein S16 1 79 3.1e-27 T 05-Jul-2010 IPR000307 Ribosomal protein S16 Molecular Function: structural constituent of ribosome (GO:0003735), Cellular Component: intracellular (GO:0005622), Cellular Component: ribosome (GO:0005840), Biological Process: translation (GO:0006412) Q9RHD9 D44DAE8C544CB7C1 267 superfamily SSF50249 Nucleic acid-binding proteins 67 220 7.6e-41 T 05-Jul-2010 IPR016027 Nucleic acid-binding, OB-fold-like Q9RHD9 D44DAE8C544CB7C1 267 superfamily SSF50249 Nucleic acid-binding proteins 3 61 1.4e-14 T 05-Jul-2010 IPR016027 Nucleic acid-binding, OB-fold-like Y902_MYCTU CD84A335CCFFE6D7 446 superfamily SSF55874 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 303 444 8e-31 T 05-Jul-2010 IPR003594 ATP-binding region, ATPase-like Molecular Function: ATP binding (GO:0005524) Y902_MYCTU CD84A335CCFFE6D7 446 superfamily SSF47384 Homodimeric domain of signal transducing histidine kinase 220 292 4.8e-12 T 05-Jul-2010 IPR009082 Signal transduction histidine kinase, homodimeric Molecular Function: signal transducer activity (GO:0004871), Biological Process: signal transduction (GO:0007165) Q9RHD9 D44DAE8C544CB7C1 267 Seg seg seg 29 40 NA ? 05-Jul-2010 NULL NULL Q9RHD9 D44DAE8C544CB7C1 267 Seg seg seg 84 98 NA ? 05-Jul-2010 NULL NULL Q9RHD9 D44DAE8C544CB7C1 267 Seg seg seg 222 237 NA ? 05-Jul-2010 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 44 55 NA ? 05-Jul-2010 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 108 120 NA ? 05-Jul-2010 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 160 173 NA ? 05-Jul-2010 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 308 319 NA ? 05-Jul-2010 NULL NULL Y902_MYCTU CD84A335CCFFE6D7 446 Seg seg seg 400 424 NA ? 05-Jul-2010 NULL NULL |
| Program name | Description |
|---|---|
| antigenic | Finds antigenic sites in proteins |
| digest | Reports on protein proteolytic enzyme or reagent cleavage sites |
| echlorop | Reports presence of chloroplast transit peptides |
| elipop | Prediction of lipoproteins |
| emast | Motif detection |
| ememe | Multiple EM for Motif Elicitation |
| ememetext | Multiple EM for Motif Elicitation. Text file only |
| enetnglyc | Reports N-glycosylation sites in human proteins |
| enetoglyc | Reports mucin type GalNAc O-glycosylation sites in mammalian proteins |
| enetphos | Reports ser, thr and tyr phosphorylation sites in eukaryotic proteins |
| epestfind | Finds PEST motifs as potential proteolytic cleavage sites |
| eprop | Reports propeptide cleavage sites in proteins |
| esignalp | Reports protein signal cleavage sites |
| etmhmm | Reports transmembrane helices |
| eyinoyang | Reports O-(beta)-GlcNAc attachment sites |
| fuzzpro | Search for patterns in protein sequences |
| fuzztran | Search for patterns in protein sequences (translated) |
| helixturnhelix | Identify nucleic acid-binding motifs in protein sequences |
| oddcomp | Identify proteins with specified sequence word composition |
| omeme | Motif detection |
| patmatdb | Searches protein sequences with a sequence motif |
| patmatmotifs | Scan a protein sequence with motifs from the PROSITE database |
| pepcoil | Predicts coiled coil regions in protein sequences |
| preg | Regular expression search of protein sequence(s) |
| pscan | Scans protein sequence(s) with fingerprints from the PRINTS database |
| sigcleave | Reports on signal cleavage sites in a protein sequence |
The original iprscan application must be installed and configured to use this wrapper.
Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.