![]() |
ehmmsearch |
Please help by correcting and extending the Wiki pages.
Usage:
hmmsearch [options] hmmfile seqfile outfile
The outfile parameter is new to EMBASSY HMMER.
hmmsearch reads an HMM from
% ehmmsearch ../ehmmcalibrate-keep/globino.hmm Artemia.fa globino.ehmmsearch -a 100 Search a sequence database with a profile HMM /shared/software/bin/hmmsearch -A 100 -E 10.000000 -T -1000000.000000 -Z 0 --domE 1000000.000000 --domT -1000000.000000 ../ehmmcalibrate-keep/globino.hmm ../../data/hmmnew/Artemia.fa > globino.ehmmsearch |
Go to the input files for this example
Go to the output files for this example
More or less all options documented as "expert" in the original hmmer user guide are given in ACD as "advanced" options (-options must be specified on the command-line in order to be prompted for a value for them).
Search a sequence database with a profile HMM Version: EMBOSS:6.5.0.0 Standard (Mandatory) qualifiers: [-hmmfile] infile File of HMMs. [-seqfile] seqall File of input sequences. -a integer [100] Limits the alignment output to the |
Qualifier | Type | Description | Allowed values | Default |
---|---|---|---|---|
Standard (Mandatory) qualifiers | ||||
[-hmmfile] (Parameter 1) |
infile | File of HMMs. | Input file | Required |
[-seqfile] (Parameter 2) |
seqall | File of input sequences. | Readable sequence(s) | Required |
-a | integer | Limits the alignment output to the <n> best scoring domains. -A0 shuts off the alignment output and can be used to reduce the size of output files. | Any integer value | 100 |
[-outfile] (Parameter 3) |
outfile | The output consists of four sections: a ranked list of the best scoring sequences, a ranked list of the best scoring domains, alignments for all the best scoring domains, and a histogram of the scores. A sequence score may be higher than a domain score for the same sequence if there is more than one domain in the sequence; the sequence score takes into account all the domains. All sequences scoring above the -E and -T cutoffs are shown in the frst list, then every domain found in this list is shown in the second list of domain hits. If desired, E-value and bit score thresholds may also be applied to the domain list using the -domE and -domT options. | Output file | <*>.ehmmsearch |
Additional (Optional) qualifiers | ||||
-e | float | Set the E-value cutoff for the per-sequence ranked hit list to <x>, where <x> is a positive real number. The default is 10.0. Hits with E-values better than (less than) this threshold will be shown. | Any numeric value | 10. |
-t | float | Set the bit score cutoff for the per-sequence ranked hit list to <x>, where <x> is a real number. The default is negative infinity; by default, the threshold is controlled by E-value and not by bit score. Hits with bit scores better than (greater than) this threshold will be shown. | Any numeric value | -1000000. |
Advanced (Unprompted) qualifiers | ||||
-z | integer | Calculate the E-value scores as if we had seen a sequence database of <n> sequences. The default is the number of sequences seen in your database file <seqfile>. | Any integer value | 0 |
-compat | boolean | Use the output format of HMMER 2.1.1, the 1998-2001 public release; provided so 2.1.1 parsers don't have to be rewritten. | Boolean value Yes/No | No |
-cpu | integer | Sets the maximum number of CPUs that the program will run on. The default is to use all CPUs in the machine. Overrides the HMMER NCPU environment variable. Only affects threaded versions of HMMER (the default on most systems). | Any integer value | 0 |
-cutga | boolean | Use Pfam GA (gathering threshold) score cutoffs. Equivalent to -globT <GA1> -domT <GA2>, but the GA1 and GA2 cutoffs are read from each HMM in the input HMM database individually. hmmbuild puts these cutoffs there if the alignment file was annotated in a Pfam-friendly alignment format (extended SELEX or Stockholm format) and the optional GA annotation line was present. If these cutoffs are not set in the HMM file, -cut ga doesn't work. | Boolean value Yes/No | No |
-cuttc | boolean | Use Pfam TC (trusted cutoff) score cutoffs. Equivalent to -globT <TC1> -domT <TC2>, but the TC1 and TC2 cutoffs are read from each HMM in hmmfile individually. hmmbuild puts these cutoffs there if the alignment file was annotated in a Pfam-friendly alignment format (extended SELEX or Stockholm format) and the optional TC annotation line was present. If these cutoffs are not set in the HMM file, -cut tc doesn't work. | Boolean value Yes/No | No |
-cutnc | boolean | Use Pfam NC (noise cutoff) score cutoffs. Equivalent to -globT <NC1> -domT <NC2>, but the NC1 and NC2 cutoffs are read from each HMM in hmmfile individually. hmmbuild puts these cutoffs there if the alignment file was annotated in a Pfam-friendly alignment format (extended SELEX or Stockholm format) and the optional NC annotation line was present. If these cutoffs are not set in the HMM file, -cut nc doesn't work. | Boolean value Yes/No | No |
-dome | float | Set the E-value cutoff for the per-domain ranked hit list to <x>, where <x> is a positive real number. The default is infinity; by default, all domains in the sequences that passed the frst threshold will be reported in the second list, so that the number of domains reported in the per-sequence list is consistent with the number that appear in the per-domain list. | Any numeric value | 1000000. |
-domt | float | Set the bit score cutoff for the per-domain ranked hit list to <x>, where <x> is a real number. The default is negative infinity; by default, all domains in the sequences that passed the frst threshold will be reported in the second list, so that the number of domains reported in the per-sequence list is consistent with the number that appear in the per-domain list. Important note: only one domain in a sequence is absolutely controlled by this parameter, or by -domT. The second and subsequent domains in a sequence have a de facto bit score threshold of 0 because of the details of how HMMER works. HMMER requires at least one pass through the main model per sequence; to do more than one pass (more than one domain) the multidomain alignment must have a better score than the single domain alignment, and hence the extra domains must contribute positive score. See the Users' Guide for more detail. | Any numeric value | -1000000. |
-forward | boolean | Use the Forward algorithm instead of the Viterbi algorithm to determine the per-sequence scores. Per-domain scores are still determined by the Viterbi algorithm. Some have argued that Forward is a more sensitive algorithm for detecting remote sequence homologues; my experiments with HMMER have not confrmed this, however. | Boolean value Yes/No | No |
-nulltwo | boolean | Turn off the post hoc second null model. By default, each alignment is rescored by a postprocessing step that takes into account possible biased composition in either the HMM or the target sequence. This is almost essential in database searches, especially with local alignment models. There is a very small chance that this postprocessing might remove real matches, and in these cases --null2 may improve sensitivity at the expense of reducing specifcity by letting biased composition hits through. | Boolean value Yes/No | No |
-pvm | boolean | Run on a Parallel Virtual Machine (PVM). The PVM must already be running. The client program hmmpfam-pvm must be installed on all the PVM nodes. The HMM database hmmfile and an associated GSI index file hmmfile.gsi must also be installed on all the PVM nodes. (The GSI index is produced by the program hmmindex.) Because the PVM implementation is I/O bound, it is highly recommended that each node have a local copy of hmmfile rather than NFS mounting a shared copy. Optional PVM support must have been compiled into HMMER for -pvm to function. | Boolean value Yes/No | No |
-xnu | boolean | Turn on XNU filtering of target protein sequences. Has no effect on nucleic acid sequences. In trial experiments, -xnu appears to perform less well than the default post hoc null2 model. | Boolean value Yes/No | No |
Associated qualifiers | ||||
"-seqfile" associated seqall qualifiers | ||||
-sbegin2 -sbegin_seqfile |
integer | Start of each sequence to be used | Any integer value | 0 |
-send2 -send_seqfile |
integer | End of each sequence to be used | Any integer value | 0 |
-sreverse2 -sreverse_seqfile |
boolean | Reverse (if DNA) | Boolean value Yes/No | N |
-sask2 -sask_seqfile |
boolean | Ask for begin/end/reverse | Boolean value Yes/No | N |
-snucleotide2 -snucleotide_seqfile |
boolean | Sequence is nucleotide | Boolean value Yes/No | N |
-sprotein2 -sprotein_seqfile |
boolean | Sequence is protein | Boolean value Yes/No | N |
-slower2 -slower_seqfile |
boolean | Make lower case | Boolean value Yes/No | N |
-supper2 -supper_seqfile |
boolean | Make upper case | Boolean value Yes/No | N |
-scircular2 -scircular_seqfile |
boolean | Sequence is circular | Boolean value Yes/No | N |
-sformat2 -sformat_seqfile |
string | Input sequence format | Any string | |
-iquery2 -iquery_seqfile |
string | Input query fields or ID list | Any string | |
-ioffset2 -ioffset_seqfile |
integer | Input start position offset | Any integer value | 0 |
-sdbname2 -sdbname_seqfile |
string | Database name | Any string | |
-sid2 -sid_seqfile |
string | Entryname | Any string | |
-ufo2 -ufo_seqfile |
string | UFO features | Any string | |
-fformat2 -fformat_seqfile |
string | Features format | Any string | |
-fopenfile2 -fopenfile_seqfile |
string | Features file name | Any string | |
"-outfile" associated outfile qualifiers | ||||
-odirectory3 -odirectory_outfile |
string | Output directory | Any string | |
General qualifiers | ||||
-auto | boolean | Turn off prompts | Boolean value Yes/No | N |
-stdout | boolean | Write first file to standard output | Boolean value Yes/No | N |
-filter | boolean | Read first file from standard input, write first file to standard output | Boolean value Yes/No | N |
-options | boolean | Prompt for standard and additional values | Boolean value Yes/No | N |
-debug | boolean | Write debug output to program.dbg | Boolean value Yes/No | N |
-verbose | boolean | Report some/full command line options | Boolean value Yes/No | Y |
-help | boolean | Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose | Boolean value Yes/No | N |
-warning | boolean | Report warnings | Boolean value Yes/No | Y |
-error | boolean | Report errors | Boolean value Yes/No | Y |
-fatal | boolean | Report fatal errors | Boolean value Yes/No | Y |
-die | boolean | Report dying program messages | Boolean value Yes/No | Y |
-version | boolean | Report version number and exit | Boolean value Yes/No | N |
ehmmsearch reads any normal sequence USAs.
HMMER2.0 [2.3.2] NAME globins50 LENG 143 ALPH Amino RF no CS no MAP yes COM /home/pmr/local/bin/hmmbuild -n globins50 --pbswitch 1000 --archpri 0.850000 --idlevel 0.620000 --swentry 0.500000 --swexit 0.500000 --wgsc -A -F globin.hmm ../../data/hmmnew/globins50.msf COM /home/pmr/local/bin/hmmcalibrate --mean 350.000000 --num 5000 --sd 350.000000 --seed 1 ../ehmmbuild-keep/globin.hmm NSEQ 50 DATE Fri Jul 15 12:00:00 2011 CKSUM 9858 XT -8455 -4 -1000 -1000 -8455 -4 -8455 -4 NULT -4 -8455 NULE 595 -1558 85 338 -294 453 -1158 197 249 902 -1085 -142 -21 -313 45 531 201 384 -1998 -644 EVD -35.959286 0.267496 HMM A C D E F G H I K L M N P Q R S T V W Y m->m m->i m->d i->m i->i d->m d->d b->m m->e -450 * -1900 1 591 -1587 159 1351 -1874 -201 151 -1600 998 -1591 -693 389 -1272 595 42 -31 27 -693 -1797 -1134 14 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 -450 * 2 -926 -2616 2221 2269 -2845 -1178 -325 -2678 -300 -2596 -1810 220 -1592 939 -974 -671 -939 -2204 -2785 -1925 15 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 3 -638 -1715 -680 497 -2043 -1540 23 -1671 2380 -1641 -840 -222 -1595 437 1040 -564 -523 -1363 2124 -1313 16 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 4 829 -1571 -37 660 -1856 -873 152 -1578 894 -1573 -678 769 -1273 1284 58 224 447 -1175 -1782 -1125 17 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 5 369 -433 -475 286 -974 -1312 -19 -412 664 398 406 1030 -1394 388 -214 -261 85 -166 -1227 -725 18 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 6 -1291 -884 -3696 -3261 -1137 -3425 -2802 2322 -3066 111 19 -3028 -3275 -2855 -3100 -2670 -1269 2738 -2450 -2062 19 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 7 157 -413 -236 316 -1387 -1231 89 -863 1084 -431 -348 910 -1319 635 297 15 704 -483 -1497 -922 20 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 8 770 -1431 -43 459 -1751 -340 78 -1449 440 -1497 -631 866 -1302 825 -51 953 364 -1076 -1750 -1121 21 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 9 420 -186 -2172 -1577 8 -1818 -694 1477 -1281 760 614 -1299 -1867 -1001 -1262 -189 -12 1401 -722 -364 22 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 10 -961 -879 -2277 -1821 1366 -2213 -204 -399 -1500 -130 -39 -1427 -2266 -1186 -1511 -159 -913 -367 4721 1177 23 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 11 -48 -1782 809 844 -2073 1456 8 -1811 315 -1803 -932 180 -1365 921 -218 173 -115 -1399 -2018 -1327 24 [Part of this file has been deleted for brevity] - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 128 -415 -1926 1575 1399 -2219 -1163 17 -1983 527 -1929 -1039 341 -1367 1597 -212 257 -222 -1536 -2109 -1387 144 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 129 -529 -1434 -629 -143 -1926 -626 -171 -1460 2679 -1597 -839 -309 -1599 207 317 -530 -510 -130 -1840 -1369 145 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 130 811 -397 -2389 -1807 1883 -2039 -907 594 -1512 1077 687 -1532 -2065 -1201 -1483 -1125 -465 1067 -843 -472 146 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 131 -241 -102 -2327 -1710 724 -1767 -616 650 -1363 1074 1765 -718 -1809 -1026 -1252 -842 -181 1331 -541 695 147 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 132 723 95 385 823 -1820 -1168 167 -1540 875 -1362 -644 320 -1261 810 246 693 -67 -1141 -1753 -1098 148 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 133 551 -430 -1049 -481 -442 469 -241 465 -313 133 947 -411 -1543 197 -587 -146 202 522 -843 -429 149 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 134 -1086 -777 -3351 -2800 816 -2898 -1861 1501 -2515 1149 586 -2483 -2775 -2108 -2400 -2046 -1030 2380 -1511 -1216 150 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 135 1393 1409 -876 -345 -997 -525 -315 -590 -198 -847 -109 -420 -1441 -97 412 766 -130 139 -1306 -858 151 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 136 98 -1299 36 365 -1495 -1211 1241 -404 523 -952 -426 1174 -1303 511 -18 347 882 -853 -1566 -970 152 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 137 1308 -787 564 -132 -966 -1332 -203 -362 -49 -395 -57 -305 -1481 49 -437 -190 -182 1020 -1282 -802 153 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 138 -1746 -1358 -3897 -3341 -216 -3621 -2478 1774 -3040 2442 1157 -3189 -3229 -2422 -2853 -2824 -1659 392 -1720 -1647 154 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 139 1176 -1289 -179 534 -1606 -607 34 -1278 734 -1372 -534 44 -1325 433 -89 521 826 -941 -1666 -1072 155 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6528 -7571 -894 -1115 -701 -1378 * * 140 602 -1500 -135 850 -1753 -1214 1951 -1452 838 -1484 431 118 -1306 555 347 489 -153 -1085 -1723 -1092 156 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -22 -6602 -7644 -894 -1115 -701 -1378 * * 141 351 -1646 -165 546 -1976 -498 46 -1667 2193 -1662 -798 35 -1405 476 311 -73 -306 -1287 -1859 -1254 157 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -23 -6561 -7603 -894 -1115 -701 -1378 * * 142 -1995 -1606 -3095 -2870 1739 -3015 -98 -1012 -2520 -730 655 -1990 -2962 -1884 -2326 -2167 -1915 -1128 548 4089 158 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45 96 359 117 -369 -294 -249 - -25 -6455 -7497 -894 -1115 -701 -1378 * * 143 -253 -1373 -267 301 -911 -565 1956 -450 1188 -1330 -497 33 -1352 502 1358 -205 -184 -941 -1604 -1026 159 - * * * * * * * * * * * * * * * * * * * * - * * * * * * * * 0 // |
>S13421 S13421 GLOBIN - BRINE SHRIMP DKATIKRTWATVTDLPSFGRNVFLSVFAAK PEYKNLFVEFRNIPASELASSERLLYHGGR VLSSIDEAIAGIDTPDRAVKTLLALGERHI SRGTVRRHFEAFSYAFIDELKQRGVESADL AAWRRGWDNIVNVLEAGLLRRQIDLEVTGL SCVDVANIQESWSKVSGDLKTTGSVVFQRM INGHPEYQQLFRQFRDVDLDKLGESNSFVA HVFRVVAAFDGIIHELDNNQFIVSTLKKLG EQHIARGTDISHFQNFRVTLLEYLKENGMN GAQKASWNKAFDAFEKYISMGLSSLKRVDP ITGLSGLEKNAILSTWGKVRGNLQEVGKAT FGKLFTAHPEYQQMFRFSQGMPLASLVESP KFAAHTQRVVSALDQTLLALNRPSDFVYMI KELGLDHINRGTDRSHFENYQVVFIEYLKE TLGDSLDEFTVKSFNHVFEVIISFLNEGLR QADIVDPVTHLTGRQKEMIKASWSKARTDL RSLGQELFMRMFKAHPEYQTLFVNKGFADV PLVSLREDERFISHMANVLGGFDTLLQNLD ESSYFIYSLRNLGDAHIQRKAGTQHFRSFE AILIPILQESQGLDAASVEAWKKFFDVSIG VIAQGLKVATSEEADPVTGLYGKEIVALRQ AFAAVTPRNVEIGKRVFAKLFAAHPEYKNL FKKFEQYSVEELPSTDAFHYHISLVMNRFS SIGKVIDDNVSFVYLLKKLGREHIKRGLSR KQFDQFVELYIAEISSELSDTGRNGLEKVL TFATGVIEQGLFQLGQVDSNTLTALEKQSI QDIWSNLRSTGLQDLAVKIFTRLFSAHPEY KLLFTGRFGNVDNINENAPFKAHLHRVLSA FDIVISTLDDSEHLIRQLKDLGLFHTRLGM TRSHFDNFATAFLSVAQDIAPNQLTVLGRE SLNKGFKLMHGVIEEGLLQLERINPITGLS AREVAVVKQTWNLVKPDLMGVGMRIFKSLF EAFPAYQAVFPKFSDVPLDKLEDTPAVGKH SISVTTKLDELIQTLDEPANLALLARQLGE DHIVLRVNKPMFKSFGKVLVRLLENDLGQR FSSFASRSWHKAYDVIVEYIEEGLQQSYKQ DPVTGITDAEKALVQESWDLLKPDLLGLGR KIFTKVFTKHPDYQILFTRTGFGDTPLTKL DDNPAFGTHIIKVMRAFDHVIQILGKPKTL MAYLRSVGADHIATNVERRHFQAFSNALIP VMQHDLKAQLRPDAVAAWRKGLDRIIGIID QGLIGLKEVNPQNAFSAYDIQAVQRTWALA KPDLMGKGAMVFKQLFTDHGYQPLFSNLAQ YEITGLEGSPELNTHARNVMAQLDTLVGSL QNSIELGQSLAQLGKDHVPRKVNRVHFKDF AEHFIPLMKADLGDEFTPLAESAWKRAFDV MIATIEQGQEGSSHALSSFLTNPVA |
hmmsearch - search a sequence database with a profile HMM HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: ../ehmmcalibrate-keep/globino.hmm [globins50] Sequence database: ../../data/hmmnew/Artemia.fa per-sequence score cutoff: >= -1000000.0 per-domain score cutoff: >= -1000000.0 per-sequence Eval cutoff: <= 10 per-domain Eval cutoff: <= 1e+06 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query HMM: globins50 Accession: [none] Description: [none] [HMM has been calibrated; E-values are empirical estimates] Scores for complete sequences (score includes all domains): Sequence Description Score E-value N -------- ----------- ----- ------- --- S13421 S13421 GLOBIN - BRINE SHRIMP 474.3 1.7e-143 9 Parsed for domains: Sequence Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- S13421 7/9 932 1075 .. 1 143 [] 76.9 7.3e-24 S13421 2/9 153 293 .. 1 143 [] 63.7 6.8e-20 S13421 3/9 307 450 .. 1 143 [] 59.8 9.8e-19 S13421 8/9 1089 1234 .. 1 143 [] 57.6 4.5e-18 S13421 9/9 1248 1390 .. 1 143 [] 52.3 1.8e-16 S13421 1/9 1 143 [. 1 143 [] 51.2 4e-16 S13421 4/9 464 607 .. 1 143 [] 46.7 8.6e-15 S13421 6/9 775 918 .. 1 143 [] 42.2 2e-13 S13421 5/9 623 762 .. 1 143 [] 23.9 6.6e-08 Alignments of top-scoring domains: S13421: domain 7 of 9, from 932 to 1075: score 76.9, E = 7.3e-24 *->eekalvksvwgkveknveevGaeaLerllvvyPetkryFpkFkdLss +e a vk+ w+ v+ ++ vG +++ l++ +P+ +++FpkF d+ S13421 932 REVAVVKQTWNLVKPDLMGVGMRIFKSLFEAFPAYQAVFPKFSDVPL 978 adavkgsakvkahgkkVltalgdavkkldd...lkgalakLselHaqklr d++++++ v +h V t+l++ ++ ld++ +l+ ++L+e H+ lr S13421 979 -DKLEDTPAVGKHSISVTTKLDELIQTLDEpanLALLARQLGEDHIV-LR 1026 vdpenfkllsevllvvlaeklgkeftpevqaalekllaavataLaakYk< v+ fk +++vl+ l++ lg+ f+ ++ +++k+++++++ +++ + S13421 1027 VNKPMFKSFGKVLVRLLENDLGQRFSSFASRSWHKAYDVIVEYIEEGLQ 1075 [Part of this file has been deleted for brevity] lrvdpenfkllsevllvvlaeklgkeftpevqaalekllaavataLaakY l + + +f +++++l v ++ ++++t +l+k ++++ ++++ S13421 868 LGMTRSHFDNFATAFLSVAQDIAPNQLTVLGRESLNKGFKLMHGVIEEGL 917 k<-* S13421 918 L 918 S13421: domain 5 of 9, from 623 to 762: score 23.9, E = 6.6e-08 *->eekalvksvwgkveknveevGaeaLerllvvyPetkryFpkFkdLss +e ++++++ v+ e+G+ ++++l+ +Pe k+ F+kF++ s S13421 623 KEIVALRQAFAAVTPRNVEIGKRVFAKLFAAHPEYKNLFKKFEQYSV 669 adavkgsakvkahgkkVltalgdavkkldd...lkgalakLselHaqklr +++ ++ + h + V++ ++ + k +dd+ + l+kL++ H+++ S13421 670 -EELPSTDAFHYHISLVMNRFSSIGKVIDDnvsFVYLLKKLGREHIKRGL 718 vdpenfkllsevllvvlaeklgkeftpevqaalekllaavataLaakYk< ++ ++++ + ++ ++e++ lek+l ++++ S13421 719 SRKQFDQFVELYI-----AEISSELSDTGRNGLEKVLTFATGVIEQGLF 762 -* S13421 - - Histogram of all scores: score obs exp (one = represents 1 sequences) ----- --- --- 474 1 0|= % Statistical details of theoretical EVD fit: mu = -35.9593 lambda = 0.2675 chi-sq statistic = 0.0000 P(chi-square) = 0 Total sequences searched: 1 Whole sequence top hits: tophits_s report: Total hits: 1 Satisfying E cutoff: 1 Total memory: 20K Domain top hits: tophits_s report: Total hits: 9 Satisfying E cutoff: 9 Total memory: 26K |
-h : Use -help to get help information instead. -informat : All common sequence file formats are supported automatically.
The following additional options are provided:
-outfile : Multiple sequence alignment output file.
WWW home: http://hmmer.wustl.edu/ Distribution: ftp://ftp.genetics.wustl.edu/pub/eddy/hmmer/
set path=(/usr/local/hmmer/bin/ $path) rehash
Please read the 'Notes' section below for a description of the differences between the original and EMBASSY HMMER, particularly which application command line options are supported.
BLASTDB location of sequence databases to be searched BLASMAT location of substitution matrices HMMERDB location of HMMs
Program name | Description |
---|---|
ehmmalign | Align sequences to an HMM profile |
ehmmbuild | Build a profile HMM from an alignment |
ehmmcalibrate | Calibrate HMM search statistics |
ehmmconvert | Convert between profile HMM file formats |
ehmmemit | Generate sequences from a profile HMM |
ehmmfetch | Retrieve an HMM from an HMM database |
ehmmindex | Create a binary SSI index for an HMM database |
ehmmpfam | Search one or more sequences against an HMM database |
libgen | Generate discriminating elements from alignments |
ohmmalign | Align sequences with an HMM |
ohmmbuild | Build HMM |
ohmmcalibrate | Calibrate a hidden Markov model |
ohmmconvert | Convert between HMM formats |
ohmmemit | Extract HMM sequences |
ohmmfetch | Extract HMM from a database |
ohmmindex | Index an HMM database |
ohmmpfam | Align single sequence with an HMM |
ohmmsearch | Search sequence database with an HMM |
Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.
Jon Ison
European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK
Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.
This program is an EMBASSY wrapper to a program written by Sean Eddy as part of his hmmer package.
Please report any bugs to the EMBOSS bug team in the first instance, not to Sean Eddy.
None